KEGG   Xylella fastidiosa 9a5c: XF0303Help
Entry
XF0303            CDS       T00033                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XF0303 (tpiA)
   01230 Biosynthesis of amino acids
    XF0303 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XF0303 (tpiA)
   00051 Fructose and mannose metabolism
    XF0303 (tpiA)
   00562 Inositol phosphate metabolism
    XF0303 (tpiA)
Enzymes [BR:xfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XF0303 (tpiA)
Exosome [BR:xfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XF0303 (tpiA)
  Exosomal proteins of bladder cancer cells
   XF0303 (tpiA)
  Exosomal proteins of melanoma cells
   XF0303 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317821..318570
Genome map
AA seq 249 aa AA seqDB search
MRPKIVAGNWKLHGSHAFAQALVAQVAAGLPLLGVSVIILPPLLYLSDLAQRFKGEGLAF
GAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHEDSELVARKFAAALSAGL
RPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLIAYEPVWAIGTGRHADPS
QVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFSQQDVDGGLIGGASLVADD
FLAIARATV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccaagattgtggctgggaattggaagttgcatggtagccacgcgtttgcacag
gcattggttgcgcaggtcgctgctggtttgccgcttcttggagtcagtgtgattatcttg
cctccattgctgtatctgagtgatttggcgcagcgcttcaaaggggaaggtttggcgttt
ggtgcgcagaacgtcagtcaccatgataaaggtgcttacactggggaagtttcggcggcg
atggtggctgatgtcggtgctcattacactttggttgggcattctgaacgtcgggagtat
caccatgaggacagtgagttggtggcgcgtaaatttgctgctgctctgagtgctggcttg
cgaccaattctatgtgttggggagagtttgccacagcgtgaggctggacaggcagaggtt
gccattgcgatgcagcttgcgcctgtgttggctctggttggcccgcagggtgttgcccgt
ggcttgattgcctatgagccggtttgggcgattggtactggccgtcatgcggatccgagc
caagtccaagcgatgcacgcttttattcgtggtgaaattgcgaggcaagatgctagaatc
ggcgattctctgttgattctatacggaggcggcatcaagccttgcaatgctgctgagttg
ttttcccagcaggatgtcgatggtgggttgattggtggtgcttcgttggttgctgatgat
ttcttggctatcgctcgtgcgacggtttag

DBGET integrated database retrieval system