KEGG   Xylella fastidiosa 9a5c: XF0366Help
Entry
XF0366            CDS       T00033                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XF0366
Enzymes [BR:xfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XF0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(373267..374220)
Genome map
AA seq 317 aa AA seqDB search
MHSVVVVGSFSIDHVWRCDTLPTPGATIAGRYSRGPGGKGFNQAVAACRVGARTYFICAL
GNDTDGNMARDIATKDGFTLIGESSTEPTGTGGIYVDSHGHNTIVTGAGANAVLSTHFIT
EQRALITSAWIILAQLESPIETLETALSMAREAGRLTILNAAPANATATINLLKLADVLT
LNETEFVALLSRHVGERISPDNVATTDGNTLHALCNKLLSDSTVVITLGSAGVFVSHSEE
NLRGDTQPYYRVAAEQAHTVDTTGAGDAFNGALAASLARQPNTAFIQHIRLANSYAARST
ETEGGAVSMPILTTTPD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagtcgtcgtcgtcggctccttcagtattgatcatgtttggcgctgcgacaca
ttgcccacacctggtgcaacaattgccggccgctatagccgtggtccaggaggcaaaggc
ttcaaccaggccgtagcggcttgccgcgttggtgcacgcacctatttcatatgcgcactc
ggcaatgacaccgacggcaacatggcacgcgacatcgccacaaaagacggcttcacactg
atcggcgaatccagcaccgaacccactggtaccggagggatctatgtcgacagccacggc
cataacaccatcgtcactggcgctggtgccaacgcagtactgagcacccacttcatcaca
gaacaacgcgccctaattacctcagcatggatcatcttggcgcaactggaatcaccgata
gaaacactcgaaacggcgctcagcatggcgcgcgaagctggccgcttgaccatactcaat
gctgcccccgccaatgcaaccgccacgatcaacctgctcaaattggccgacgtgctcacg
ctcaacgaaacggaattcgtcgccttgctcagccgtcacgtcggtgaaaggatcagtccc
gacaacgtcgccaccaccgatggcaacacactacatgccttatgcaacaagctactgtcc
gacagtacggttgtcattacattaggctcagctggcgtattcgtttcacactcggaagaa
aacctgcgtggtgacacccagccctactatcgcgtggccgccgaacaggcccacaccgta
gacaccaccggagctggcgacgcatttaatggtgctttggcagcatccctggcacggcaa
ccaaacacagcgtttatccagcacatacgcctcgccaatagctatgcagcgcgctcgacc
gaaacagaaggtggagccgtatcaatgccaatattaacgactaccccagactaa

DBGET integrated database retrieval system