KEGG   Xylella fastidiosa 9a5c: XF0657Help
Entry
XF0657            CDS       T00033                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xfa00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xfa00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xfa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626294..627988
Genome map
AA seq 564 aa AA seqDB search
MFRRFATFLILPVVSFAIAVSFPSAATSTQVSVPKVTHPAAETPQWWYQSGATRAAANGA
MAGKAKNVILFLGDGMSFTTVAAARILEGQRNAATGEENVLSWEHFPATAFSKTYNTDAQ
TADSAGAMTAITSGVKTHMGAIGVSAGQRNDCVDSLGKGLLTWLTLADSAGMATGIITTT
RITHATPAALYAHTPERHWESDANLPEAAKAGGCRDIAQQLLTSTRYGRGPLVVLGGGRA
QFMPAHQHDPEYAERTGLRLDGRDLIEEWKRAHPNGAYVWNTHQFNAAAGAPALLGLFEP
SHMQFEHDRDRHPNGEPSLAEMTRTAIQSLSRDPHGFVLMVEGGRIDHAHHAGNAYRALD
ETIALSDAVRAAVQSAPKDTLIIVTADHAHTLNFVGYPVRGNPILGKVHSSSRDAGDPTQ
YAHDLNGLPYTTLTYANGPGHTAASNTQPAGTKHFDHQPRTYELVRGRPDLTTIDTEAPD
YLQEALVPLKTESHSGEDVGIWATGPGSAAFRGVLEQHVIYHVIVQATPALRQRLCAAGT
CNAAGVPIKLPQLADFERKGQRRE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttccgacgttttgctactttcctcattcttcctgtcgtgtcatttgccatagcggtt
tctttcccatctgctgccacttctacccaggtgagcgtgcccaaagtgactcatcctgcc
gctgagaccccgcaatggtggtatcagagcggcgctacacgcgctgcggctaacggtgcc
atggctggcaaagccaagaatgtcatcctatttctcggcgacggcatgagcttcaccacc
gtagccgctgcacgcatcctggaaggccaacgcaacgctgccactggcgaagagaacgta
ttgtcctgggaacatttccctgccaccgcattcagcaaaacctacaacaccgatgcccag
accgcagactcagccggtgccatgaccgcaatcacctctggagtaaagacccacatgggc
gcgatcggcgtcagtgcaggccagcgcaacgactgcgttgatagcctcggcaaaggtcta
cttacctggctgacactggcagacagcgccggtatggcgaccggcatcataacgaccacc
cgtatcactcatgccaccccggcggcgctctacgcacataccccggaacgtcattgggag
agtgatgccaacctgcctgaagccgccaaagcgggcggctgccgcgatattgcccaacaa
ctcctcacctctacccgctatgggcgtggtcctctggtggtgctgggcggtggtcgcgcc
caattcatgcctgcgcaccaacatgacccggaatatgctgagcgtactggcttacgtttg
gatggacgcgacctcattgaagaatggaaacgtgcacatcccaatggcgcttatgtgtgg
aacacccaccaattcaacgccgctgctggcgcaccggccctgctgggtttatttgagccc
agccatatgcagtttgaacacgatcgcgaccgacaccccaacggcgagcctagcttggcc
gagatgacacgtaccgcgatccaatcgctgtcccgcgatccacatggctttgtactgatg
gtcgaagggggccgcattgatcacgcccatcatgccggtaacgcctacagagccttggat
gaaaccatcgccctctcagatgcagtacgcgccgccgtacagagcgcccctaaagatacc
ttgattatcgtcactgccgaccatgcccataccctcaactttgttggctacccagtccgc
ggcaacccgatattgggcaaagtgcacagcagcagccgtgatgcaggagaccccacccag
tacgcacatgatttaaatggcttgccctataccacattgacttacgcaaacggtcctggc
cacaccgccgccagcaatacacagccggccggaaccaaacacttcgaccatcaaccccgt
acctatgaattagtccgtggtcgcccagatctgaccacgatcgacaccgaagcgcccgac
tatctgcaagaagcgctggtaccattgaagactgagagccacagcggcgaagacgtcggc
atctgggccacaggccccggcagtgctgcgtttcgcggtgtccttgaacaacatgtcatc
taccatgtcatcgtccaagcgacacccgcattacgacagcgcctgtgtgccgctggcaca
tgtaacgccgctggcgtgccgatcaagttgccacagctggccgatttcgaacgcaaaggc
cagaggagggagtga

DBGET integrated database retrieval system