KEGG   Xylella fastidiosa 9a5c: XF0818Help
Entry
XF0818            CDS       T00033                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XF0818
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XF0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(769640..771418)
Genome map
AA seq 592 aa AA seqDB search
MSFSKHFGKLMLATCLSLSAAPVFSYSISHGKVIDDKGNQIQLKGGSWFGFETTNHVVHG
LWTRNWKEFITQIQSMGLNAVRLPFCPASLNSNTSPSSIDYNRNPDLQGLSSLQIMDKVV
KELSDRGIYVLMDHHTPDCAAISELWYTDSYSEKQWIDDLRFVAHRYANVPGVIGLDVKN
EPHGRATWGTGDPKTDWNTAVEHAAAAILEAAPKWLIGVEGIGENPSCSSTIGHFWGENL
EPMDCTPLKVPADHLLLIPHVYGPDVYVQPYFNSPDFPNNMAAIWDKHFGHFAKAGYAMA
IGEFGGKYGEGDPRDVAWQNALVDYLISIGVTDTFYWSINANSSDTGGLFRDDWNHVRED
KLTLLKKLWNGKDGSGGGGGSGGGSGSGGGSGSGGGSGSGGGSGSGGGSGSGGGSGSGGG
SGSGGGSGSGGGGGSGGGSGSGGGSGSGGGSGSGGGSGSGGGSGSGGGGGSGGGGSGGGG
GSGGGSGSGGGSGSGGGSGTGGGGSDPTKSKISVNTIVDSDWHTGYCERIQVTNISNSPT
TWTVTISIRGNIQTLWSARWSVKGNALTASGMDWNKTLDPKGTTEFGFCSNY
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttccaaacacttcggcaaactcatgttggccacgtgcctatccttatctgcg
gcaccagtattcagttacagcatcagccatgggaaggtcattgatgacaaaggcaaccaa
atacaattaaagggcggcagctggtttggttttgagaccacaaatcacgtggtacacggg
ctgtggacacgcaattggaaagaattcatcacacagatacagagcatgggattgaacgca
gtgcgtctaccgttctgcccagctagtctgaacagcaacacatcaccgagcagcatcgat
tacaaccgcaatccggacttacaaggcttgagctcgctccaaatcatggacaaggtggtc
aaagagctgagcgaccgaggaatatatgtgctgatggatcaccatacgccggactgcgca
gcaatttctgaattgtggtacacggactcatacagcgaaaaacagtggattgatgatcta
cgcttcgtcgcacaccgttacgccaacgtacccggcgtcatcggcttggacgtaaagaat
gaaccacatggcagagccacttggggcaccggagatccaaaaactgattggaacaccgca
gtcgagcatgcggcagcagcgatcttggaggccgcaccaaaatggctgatcggagtcgag
gggattggagagaatcccagctgctccagcaccattgggcatttctggggcgagaacctg
gaaccgatggactgtacgccactgaaagtccctgccgaccatttgctattgataccacac
gtctacgggccagatgtctacgtacagccgtacttcaatagtcccgatttcccaaacaac
atggcagcgatctgggataaacacttcggacattttgcgaaagccggctacgcgatggcg
attggtgagttcggtggtaagtacggtgaaggtgatccacgcgatgtcgcttggcaaaac
gctctggtggattatctaatcagtatcggtgtgacggataccttctattggtccataaac
gcgaacagcagcgataccggtggcctgtttcgcgatgactggaatcacgtgcgcgaagac
aagctcaccctgctgaagaaactgtggaatggtaaagatggttccggtggtggtggtggc
tccggtggtggtagtggctccggtggtggtagtggctccggtggtggtagtggctccggt
ggtggtagtggctccggtggtggtagtggctccggtggtggtagtggctccggtggtggt
agtggctccggtggtggtagtggctccggtggtggtggtggctccggtggtggtagtggc
tccggtggtggtagtggctccggtggtggtagtggctccggtggtggtagtggctccggt
ggtggtagtggctccggtggtggtggtggctccggtggtggtggctccggtggtggtggt
ggctccggtggcggtagtggctccggtggtggtagtggctccggtggtggtagtggtacc
ggtggtggtggctccgatcctacaaagagcaagatttctgttaataccatcgtggacagc
gattggcatactggttactgcgaacggatccaagtgactaatatcagcaacagtcccact
acctggacggtgacgatttcgatcaggggcaatatccagaccctatggagcgcgcgttgg
tcagtgaagggtaacgcgctcaccgcttctggtatggactggaataagacgcttgatccg
aaaggcacgactgaattcgggttctgttcaaactattga

DBGET integrated database retrieval system