KEGG   Xylella fastidiosa 9a5c: XF0840Help
Entry
XF0840            CDS       T00033                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XF0840
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XF0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(795191..797029)
Genome map
AA seq 612 aa AA seqDB search
MLRHLLTLPLIFVIALPIGVNAAPWPAFSTRGTQFIRDGRPYQLISGAIHFQRIPRAYWK
DRLQKARAMGLNTVETYVFWNLVELREGQFDFTGNNDISAFVREAASQGLNVILRPGPYV
CAEWEAGGFPAWLFADPTLRVRSQDPRFLDASQRYLEALGTQVRPLLNGNGGPIIAVQVE
NEYGSYGDDHGYLQAVRALFIKAGLGGALLFTADGAQMLGNGTLPDVLAAVNVAPGEAKQ
ALDKLATFHPGQPQLVGEYWAGWFDQWGKPHAQTDAKQQADEIEWMLRQGHSINLYMFVG
GTSFGFMNGANFQGGPSDHYSPQTTSYDYDAALDEAGRPMPKFVLFRDVITRVTGLQPPP
LPAATRFIDLPNTPLRASASLWDNLPAAVATTADPQPMERYGQAYGYILYRTTLHGPRKG
TLYLGEVRDDARVYVDRLFVGRAERRRQQVSVEVDIPSGAHRLDVLVENSGRVNYGPHLA
DGRAGLIDPVMLNHERVNNWETFLLPLQTPEAIHGWTTAPMQGPAFHRGTLLIRTPGDTF
LDMAAFSKGVTWANGHLLGRYWDIGPQRALYFPGAWQRQGENTVLVFDVSDTAAAQVRGV
QQQRWITPRTGK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcacctgctcacgttgccactgatattcgtaatcgcgctgcccattggagtt
aacgctgcgccttggcctgctttttcaactcggggaacgcaattcatccgtgatgggagg
ccgtatcagttgatctcgggtgccatccacttccaacgcatcccacgggcgtactggaag
gaccgtttgcaaaaagcccgagcaatggggttgaacacggtggaaacctatgttttctgg
aacctggttgaactccgtgaaggtcaattcgacttcacagggaataacgacattagtgct
tttgtgcgtgaagcagcgtcgcaaggtctgaacgtgattctgcgtcccgggccgtatgtg
tgtgcagaatgggaggcaggggggttcccagcgtggctgttcgccgatccgacgctacgg
gtgcgcagtcaggatccacgttttcttgatgctagtcagcgctatctggaggcactcggc
acacaggtcaggccgctgctcaatggcaatggcggtcccatcattgcggtgcaggttgaa
aatgagtacggctcttatggggatgatcatggctatctacaggctgtccgcgcgctattc
atcaaggccggtttgggaggcgcgttgttgtttaccgccgacggggcgcagatgcttggc
aatggcacgctgccggacgtgctggcggcggtgaatgttgcaccgggtgaggcgaaacag
gcgctcgacaagctcgccacattccatcctgggcagccgcagttggtgggcgaatattgg
gcggggtggttcgaccagtggggcaagccgcacgcgcagactgatgcaaagcaacaggct
gatgagatcgaatggatgttgcggcaaggccattcgatcaatctgtatatgtttgttggc
ggcaccagttttggtttcatgaatggtgccaacttccaaggtggtcccagtgaccattac
agccctcaaaccacaagctacgattacgatgcggcgttggacgaagccggacggccgatg
ccgaagttcgtgctgttccgcgatgtcatcacccgcgtgaccggtctccagccgccgcca
ttgccagcagcaacccgttttatcgatctgccgaacacgccattgcgcgcatccgcttcg
ctctgggacaacctgcctgcagcggtcgccaccacagcagatccgcagccgatggagcgc
tatgggcaggcctacggttacattctgtaccgcaccacgctccacgggccacggaagggc
acgctgtatctgggtgaggtgcgggatgacgcccgtgtctacgttgatcgtctcttcgtg
ggtcgggcggaacggcgtcggcagcaggtctccgtagaggtcgacattccctccggtgct
caccgtctggatgtcttggtagaaaacagtggacgggttaactacggtccgcacctggct
gacggtcgcgccgggctgatcgatccggtgatgctcaatcatgaacgcgtcaacaattgg
gaaacgtttctgctgccgttgcagacgcccgaagcgatccacggttggacaaccgcaccg
atgcaaggacctgcctttcatcgtggcacgttgttgatccgcacgcctggagacacattt
ttggatatggcggctttcagcaagggagtgacttgggccaatggtcacctgcttggccgc
tactgggacatcggcccgcagcgggcgctttacttcccgggggcgtggcagcgtcaaggg
gagaacacggtgctcgtcttcgatgtgagtgatacggcagcagcacaggtacgcggtgtg
cagcagcaacgctggatcactccaaggacggggaagtaa

DBGET integrated database retrieval system