KEGG   Xylella fastidiosa 9a5c: XF0946Help
Entry
XF0946            CDS       T00033                                 

Gene name
glyA
Definition
serine hydroxymethyltransferase (EC:2.1.2.1)
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XF0946 (glyA)
   01230 Biosynthesis of amino acids
    XF0946 (glyA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XF0946 (glyA)
  Energy metabolism
   00680 Methane metabolism
    XF0946 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XF0946 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    XF0946 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    XF0946 (glyA)
Enzymes [BR:xfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     XF0946 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909556..910830
Genome map
AA seq 424 aa AA seqDB search
MFFSGVAMFPRDARLDMYDPELAKAIAAEVMRQEDHVELIASENYCSTLVMQVQGSQLTN
KYAEGYSGKRYYGGCECVDIAEQLAIERAKQLFGADYANVQPHSGSQANQAVYFALLQPG
DTILGMSLAHGGHLTHGANVNVSGKLFNAVQYGVNGQGLIDYEAVESLALEHRPKMVVAG
FSAYSQKIDWARFRAIADQVGAYLLVDMAHVAGLVAACVYPNPLPHAHVVTSTTHKTLRG
PRGGIIVAQAPQEALVKKLQSIVFPGIQGGPLMHVIAAKAVAFKEALEPAFKVYQQQVVK
NAKAMAETLMLRGYKIVSGGTENHLMLVDMIGRDVSGKDAEGALGQAHITVNKNAVPDDP
RSPFVTSGLRLGTPAVTTRGYQEQDCVDLAHWIADVLDAPADATVIAAVREKVAAQCRKY
PVYR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgtttttttccggagttgctatgttcccgcgtgatgctcgtcttgatatgtacgatccc
gaattggctaaggctattgctgctgaagtgatgcgtcaggaggatcacgttgagttgatt
gccagtgaaaattattgcagtacgttggtgatgcaggtgcaggggagtcagctgaccaat
aagtatgctgaagggtattctggaaagcgttactacggtggttgtgagtgtgtcgatatc
gctgagcaattggcgattgagcgtgccaaacagctgtttggtgctgactatgccaatgtg
cagccccatagcggttcacaagccaatcaagcggtgtactttgccctgttgcagccgggc
gatacgattctcgggatgagcttggcgcatggcggccatttgactcatggcgctaatgtc
aatgtgtctggcaagttgttcaatgcggttcagtacggagtcaatggtcaagggttgatt
gattacgaggctgttgaatcgcttgcgttagagcatcggccgaagatggttgtggcgggc
ttttcggcgtattcgcagaaaatcgattgggcgcgcttccgcgccattgctgatcaggtg
ggcgcttacttgcttgtggatatggcacatgtggccggcttggtggcggcttgtgtctat
ccgaatccgctgccgcatgctcatgttgtgacttcgacgacgcataagacactgcgcggc
ccacgtggcggcattattgtggcgcaggcaccacaggaggcgttggttaagaagttgcag
tcgattgtgtttcctgggatccagggtggtccattgatgcatgtgattgcggctaaagcg
gttgcttttaaggaagcgctggagcctgcgtttaaggtgtatcagcagcaggtggtgaag
aatgcgaaggcgatggctgagaccctcatgttacgtggctataagattgtctctggtggt
acagaaaatcatttgatgctggttgacatgatcggcagggatgtttccgggaaggatgct
gagggtgcactgggtcaggctcatatcaccgtcaataagaatgccgtgccagatgatccg
cgctctccgttcgtaacctctgggttacgcttggggactccggcagtcacgacgcggggt
taccaggagcaggattgtgtggacttagcgcactggattgctgatgtgcttgacgcgcct
gcggatgcgacggtcattgccgcagtccgtgagaaggttgcggcgcagtgcaggaagtat
cctgtgtatcgctga

DBGET integrated database retrieval system