KEGG   Xylella fastidiosa 9a5c: XF0946Help
Entry
XF0946            CDS       T00033                                 

Gene name
glyA
Definition
serine hydroxymethyltransferase (EC:2.1.2.1)
Orthology
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:xfa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:xfa01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:xfa00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:xfa00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xfa00260]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:xfa00460]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:xfa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909556..910830
Genome map
AA seq 424 aa AA seqDB search
MFFSGVAMFPRDARLDMYDPELAKAIAAEVMRQEDHVELIASENYCSTLVMQVQGSQLTN
KYAEGYSGKRYYGGCECVDIAEQLAIERAKQLFGADYANVQPHSGSQANQAVYFALLQPG
DTILGMSLAHGGHLTHGANVNVSGKLFNAVQYGVNGQGLIDYEAVESLALEHRPKMVVAG
FSAYSQKIDWARFRAIADQVGAYLLVDMAHVAGLVAACVYPNPLPHAHVVTSTTHKTLRG
PRGGIIVAQAPQEALVKKLQSIVFPGIQGGPLMHVIAAKAVAFKEALEPAFKVYQQQVVK
NAKAMAETLMLRGYKIVSGGTENHLMLVDMIGRDVSGKDAEGALGQAHITVNKNAVPDDP
RSPFVTSGLRLGTPAVTTRGYQEQDCVDLAHWIADVLDAPADATVIAAVREKVAAQCRKY
PVYR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgtttttttccggagttgctatgttcccgcgtgatgctcgtcttgatatgtacgatccc
gaattggctaaggctattgctgctgaagtgatgcgtcaggaggatcacgttgagttgatt
gccagtgaaaattattgcagtacgttggtgatgcaggtgcaggggagtcagctgaccaat
aagtatgctgaagggtattctggaaagcgttactacggtggttgtgagtgtgtcgatatc
gctgagcaattggcgattgagcgtgccaaacagctgtttggtgctgactatgccaatgtg
cagccccatagcggttcacaagccaatcaagcggtgtactttgccctgttgcagccgggc
gatacgattctcgggatgagcttggcgcatggcggccatttgactcatggcgctaatgtc
aatgtgtctggcaagttgttcaatgcggttcagtacggagtcaatggtcaagggttgatt
gattacgaggctgttgaatcgcttgcgttagagcatcggccgaagatggttgtggcgggc
ttttcggcgtattcgcagaaaatcgattgggcgcgcttccgcgccattgctgatcaggtg
ggcgcttacttgcttgtggatatggcacatgtggccggcttggtggcggcttgtgtctat
ccgaatccgctgccgcatgctcatgttgtgacttcgacgacgcataagacactgcgcggc
ccacgtggcggcattattgtggcgcaggcaccacaggaggcgttggttaagaagttgcag
tcgattgtgtttcctgggatccagggtggtccattgatgcatgtgattgcggctaaagcg
gttgcttttaaggaagcgctggagcctgcgtttaaggtgtatcagcagcaggtggtgaag
aatgcgaaggcgatggctgagaccctcatgttacgtggctataagattgtctctggtggt
acagaaaatcatttgatgctggttgacatgatcggcagggatgtttccgggaaggatgct
gagggtgcactgggtcaggctcatatcaccgtcaataagaatgccgtgccagatgatccg
cgctctccgttcgtaacctctgggttacgcttggggactccggcagtcacgacgcggggt
taccaggagcaggattgtgtggacttagcgcactggattgctgatgtgcttgacgcgcct
gcggatgcgacggtcattgccgcagtccgtgagaaggttgcggcgcagtgcaggaagtat
cctgtgtatcgctga

DBGET integrated database retrieval system