KEGG   Xylella fastidiosa 9a5c: XF1004Help
Entry
XF1004            CDS       T00033                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XF1004
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XF1004
Enzymes [BR:xfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XF1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962344..963498
Genome map
AA seq 384 aa AA seqDB search
MTGTPPPSRFPEQPIPPWRRAVLKVGSSLLAAAGGGLSPRFALDLAHFVSANITAGRQLV
IVSSGAVAAGRALIPPLPESGGALAARQALAALGQAQLIALWQRFFDRPVAQVLLTHDDL
RNRRRYLNARATLRELLHLGTLPVVNENDTVSVDELKLGDNDNLAAIVAALIDAQALFIA
TDIDGLYTTDPRHHPDAQPLHEVRTLTPEHLAMAGDSSSTVGTGGMRTKLEAALKAGAAG
IDTYLFNGRSSDVVRGLAQHRLRGTRIHPTCTPIAARKYWLRHAPVEPGAILIDAGAAAA
LAQQGASLLPGGVLSAEGDFRRGDMIQIATRSPDHPPHPLARGLVQYSAADVRRIAGCHS
RDIQPLLGYTYGDTIVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacccctcccccctcccgcttccccgaacaacccatccccccgtggcgccgc
gctgtcctcaaagtgggcagcagcctcctcgccgccgctggcggcggcctctccccccgc
tttgccttggatttagcacacttcgtctccgccaacatcaccgccggacgccaactggtc
atcgtctcctctggcgctgtcgccgctggccgtgccctgatacccccactgcccgaatcc
ggcggcgccctcgccgcacgccaagccttagccgcccttggacaagcacaactcatcgca
ctgtggcaacgcttcttcgaccgccccgttgcccaggtcctcctgacccatgacgacctc
cgcaaccgccgccgctacctcaacgcacgtgccacattgcgtgaactactgcacctgggc
accttgcccgtcgtcaacgaaaacgacaccgtctccgtcgatgaactcaaactgggcgac
aacgacaacctggcagccattgttgccgcactgattgatgcccaagccctgtttatcgcc
accgatattgacggcttatacaccaccgacccacgccaccatcccgacgcacagcccctg
catgaagtccgcaccctgacccctgaacacctcgccatggctggtgacagcagcagcacc
gttggcaccggcggcatgcgtaccaaactcgaagccgcacttaaagccggcgccgctggc
attgacacctacctatttaacggccgcagcagcgacgttgtccgcggactcgcacaacac
cgcctccgcggcacccgcatccatcccacctgtaccccgattgccgcccgtaaatattgg
ttgcgtcacgccccagtcgagcctggcgcgatcctcatcgatgccggtgccgccgccgcc
ttggcacaacaaggcgcttccctacttccgggcggcgttttgagtgccgaaggcgacttc
cgccgcggcgatatgatccagatagccacccgcagcccagatcaccccccacaccccctg
gcacgcggacttgtccaatactcagccgccgatgtccgccgcattgccggttgccattcc
cgcgatattcagcccctccttggatacacctatggcgacaccatcgttcaccgtgatgac
ctcgtcctcctctga

DBGET integrated database retrieval system