KEGG   Xylella fastidiosa 9a5c: XF1064Help
Entry
XF1064            CDS       T00033                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XF1064 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XF1064 (glk)
   00052 Galactose metabolism
    XF1064 (glk)
   00500 Starch and sucrose metabolism
    XF1064 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XF1064 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XF1064 (glk)
   00524 Butirosin and neomycin biosynthesis
    XF1064 (glk)
Enzymes [BR:xfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XF1064 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1022032..1023045)
Genome map
AA seq 337 aa AA seqDB search
MNAPQAPVLVADIGGTNARFALANPTLTSAPLLNDSLREFAVIEFPSLSEAAQHYLHHIG
IHTTKGVFAIAGHVDGDEARITNHPWVITRTRTATMLGFDTLHLINDFVAQAMAISVLGP
QDVIQIGSAKWEQVPLSAATRNYGIIGPGTGLGVGGLVIRNGRCYPLETEGGHVSFPPST
PEEIRILEILSQQFGRVSNERLISGPGLVNIHRALSEIDGIDPGPLRPQDITMRAADGDI
RATRTINLFCNIFGAITGDLVLIQGAWDGVFLTGGLVPKLLNSIQHSGFRQKFEHKGRFS
AIMARIPSLAVIHPHPGLLGAAAYARDTEPVPQDIKA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccacaggctcccgtactggtcgcagacattggagggactaacgcccgcttt
gcgctggccaaccccaccctaacctcagcaccactgctgaacgacagcctgcgcgaattc
gccgtcatcgaattcccctcactgagcgaagctgcacagcactacctgcatcacatcggc
atacataccaccaaaggcgtctttgcgatcgccggacacgtagacggcgatgaagcacgt
attaccaatcatccctgggtcatcacacgcacgcgcactgcaacaatgctcggcttcgac
accctgcacctcatcaacgattttgttgcccaagcgatggccatcagcgtgttaggccct
caagatgtcatccaaatcggcagtgccaaatgggagcaagtcccgctatcagcagccacc
cgcaactacggcatcattggccccggcaccggcctaggcgtcggcggcctggtgattcgc
aacggccgctgttatccgctagaaaccgagggcggccatgtcagcttcccgccaagcacc
ccagaagaaatccggatcctggaaatcctgtcacaacaattcggacgtgtctccaacgaa
cggctgatctccggtccagggctagtcaacattcaccgcgcactgagcgaaatcgacgga
atcgacccaggcccactgcgccctcaagacatcaccatgcgcgccgctgacggcgacata
cgcgccacacgcaccatcaatctgttctgcaacatcttcggcgccatcaccggcgacctg
gtactcatccaaggggcttgggatggcgtctttctgacaggcggcctcgttcccaaacta
ttgaactcaatacagcattccggtttccgccaaaaatttgaacataagggtcgattttcg
gccatcatggcccgtatcccctctttagcagtgatccatccacaccctggcctactcggc
gcagccgcatacgcacgagacaccgagccagtcccgcaggacatcaaggcatga

DBGET integrated database retrieval system