KEGG   Xylella fastidiosa 9a5c: XF1071Help
Entry
XF1071            CDS       T00033                                 

Definition
succinate dehydrogenase, membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XF1071
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XF1071
   00650 Butanoate metabolism
    XF1071
  Energy metabolism
   00190 Oxidative phosphorylation
    XF1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027825..1028208
Genome map
AA seq 127 aa AA seqDB search
MSRYRTPLKNARGLGAAKAGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAV
AKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTMVKFIAVLGAVASVFAV
VRIALGN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttaccgtacaccactcaaaaatgcccgtggtctaggtgctgctaaggcgggg
accgggcattttgtgttgcagcgcctcactgcgattgcattagtattgctgggagtatgg
tttttggcatttttgctgactttgcttggtgtcgattacgcggcagcggttgcagccgtc
gccaaaccttggaatgcaatattgctcattggcttcctggtcgctgccttttggcatgcg
cagctcggtttgcaggtggtacttgaggattacatccacaattcttttctggctttggca
ctccagacgatggtgaagttcatcgctgtgcttggcgctgtcgccagtgtttttgcggtc
gttcgtatcgcgcttgggaactga

DBGET integrated database retrieval system