KEGG   Xylella fastidiosa 9a5c: XF1250Help
Entry
XF1250            CDS       T00033                                 

Definition
arginine deaminase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XF1250
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XF1250
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XF1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203098..1203979
Genome map
AA seq 293 aa AA seqDB search
MSIIKKKTIRILFPQWQGGNQELYSLGARLLAWLAPETEAPMFEVNVPEFKKETPEPERG
VIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLWIDAHP
DIKTPQDSMNGHTMVLGSLLGEGDNEFVAKVKVPLKPSRVMFAGLIETGLTEQESEVIHR
LGLNVAKPEVLFDNSQTVIDWVCKEKIEKLVIHFDLDVLHPDVFRSLLFAEPEPEFDWRA
TYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcattaagaagaaaacaatcagaatactgtttcctcaatggcaaggtggaaat
caggagctatatagtttgggtgcacgtcttctggcttggttggcgccggaaacagaggct
cctatgtttgaggtgaatgtgcctgagtttaaaaaagaaacgcccgaaccggagagaggg
gttatctacaggcagcaattattcaagcagtatgatgaagcttatcgactgttggagcgg
gaagatccagattatgtggtgatttttggtggtgattgcctggtggatttggcgcctttt
gcttggttgaatgagaaacatcatggtcagttgggtgtgttatggattgatgctcatcct
gatataaaaacaccgcaggattctatgaatggtcacacgatggttctgggaagtttgctg
ggtgaaggtgataacgaatttgtcgcaaaggtgaaagttccgttgaagccgtccagggtg
atgtttgcagggttgattgaaacggggttgacggagcaggagagtgaggtaattcatcgc
cttggactcaatgtggccaaaccggaggtgttatttgacaacagccagacggtgattgat
tgggtctgtaaggaaaaaatcgagaagttggtgattcatttcgatctggacgttcttcat
cctgatgtatttcgctcgttgttatttgctgaaccggagccggaattcgattggcgggca
acttacccggttgggcaattgcgtttggcacaggtgatcaggttgattcgcgatgttgcc
gctgaaacggagttggtggctattggcataactgagcatcttccttgggatgtttggcac
ttgaaggagtctttaagtaaggttccattactgaatcggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system