KEGG   Xylella fastidiosa 9a5c: XF1376Help
Entry
XF1376            CDS       T00033                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XF1376 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XF1376 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XF1376 (trpA)
Enzymes [BR:xfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XF1376 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1323889..1324695
Genome map
AA seq 268 aa AA seqDB search
MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGADVIELGVPFSDPMAD
GPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLNPLEIYGIARFTQHAVA
CGVDGVLLVDLPPEEADEIRPIFSAAGLALIVLASPTTSASRLARLSGVAQGYLYYVSFS
GVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAAVMAVDADGVVVGSALVTAL
SDAPDVDTACRRADAFLAPLRQALDAVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatagacgaaacattccgccgtttaagggcgcaatcgcgcaaggcgttgatc
cctttcatcactgctggcgacccctctttggaggcggctgttccggtgatgcatgctttg
gtccgtgcgggggcggatgtgattgagttgggtgtgccgttttcggacccgatggcggat
ggtccggtgattcagcacagttccgagcgcgcgttgcagcgtggtgtgggtttggcctat
gtgttacagacagtcgatgtgttccgtcagagcgatgcagtgacgccggtggttttgatg
ggctacctcaatcctttggaaatctatggcattgcgcgttttacacagcatgcagtggct
tgtggagtggatggggtgctgcttgtggatcttcctccggaagaggcggacgagatccgc
ccgatcttctcggcggctggtttggcactcatcgttttggcatctccgacgacctctgcc
tcccgtctggcgaggttgagcggggttgcccaggggtacttgtattacgtgagtttttct
ggcgtgactggcgctgatcggcttgatgcgcagtcagccggtgatcgcttgcgtggatta
cgtgcgcagactcaagtcccggtggtggttggctttggtatcagggatgcggccagtgct
gcggtgatggcggtggatgcggatggggtggtggttggcagtgccttggtgacggcctta
agtgatgctccggatgtggacactgcctgccggcgtgctgatgcgtttttggcgccgttg
cgtcaggcgttggatgcggtgaagtag

DBGET integrated database retrieval system