KEGG   Xylella fastidiosa 9a5c: XF1424Help
Entry
XF1424            CDS       T00033                                 

Definition
chitinase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xfa  Xylella fastidiosa 9a5c
Brite
Enzymes [BR:xfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XF1424
Secretion system [BR:xfa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XF1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1371728..1372516)
Genome map
AA seq 262 aa AA seqDB search
MYRLIVALLLGIVTLTACAQPSQPSSNKTSTTPTNATPANVQQRVTAALNTLDPDFKPDY
IGAAPFPGFREVVVSGQILYVSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQ
SQRIVFAPKNPQYTISVFTDIECGYCRKLHSEIAELNKQGIAVEYLAFPRMGLGSQDYKD
MVSVWCAADRKQVLTEAKAGKQIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
YLPPEKLRALLDKLAAATAKGG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgccttatcgtcgccttgttgctaggtatcgtgaccctcaccgcctgcgcacaa
ccctcacaacccagctccaacaaaacgagcaccacaccaaccaacgccacgccagccaac
gtgcagcaacgcgtgactgccgccctcaacactctggacccagatttcaagccagactac
atcggtgccgcaccattcccgggtttccgtgaagttgtggtcagcggccaaattctgtat
gtcagcgacaacggccgctacctcattcaggcacaaccctacgacattcaaaacaaaaaa
tttgctgtcagcgaagggctgctttcctaccgccgcacccaactggccacggtgccccaa
tcgcaacgcatcgtgttcgcaccaaagaacccccaatacaccatcagcgtattcaccgac
attgaatgcggctattgccggaaactacatagcgaaatcgccgaactgaataaacaaggc
atcgccgttgaatacctcgccttcccacggatgggtttaggaagccaagattacaaagac
atggtctcggtgtggtgcgccgctgatcgtaaacaagtactgaccgaagcaaaagccggc
aaacaaatccagaataaaaattgtaataaccctgttgccttggaatacagcctaggtcaa
cgtatcggtgtcaacggcaccccagcaatcttcgccccagacggcacccagcttggcggc
tatctaccaccagaaaaactacgtgcactgttggacaaactcgccgccgcaacagctaaa
gggggctga

DBGET integrated database retrieval system