KEGG   Xylella fastidiosa 9a5c: XF1456Help
Entry
XF1456            CDS       T00033                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XF1456
Enzymes [BR:xfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     XF1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402660..1403289
Genome map
AA seq 209 aa AA seqDB search
MEFLTEHLACSTRAAITLPACMPMTEVDVVSGCMREYGMTSVLLSLGSNVRPRYYLRQAE
AALHAFFGEVLFSPVYRTLAVGFDGPDFLNSAAMVHTAMPLSDLHAWLHALEERYGRDRA
VPRFGNRTLDVDVVFYGDLIVKEPGGEYCIPRRELKHSFVLKPLVDVAPDFVDPVSGRTL
AQLWAVHPHVEACFQVVDLEVPGDDRDMI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttttgacagaacacttagcgtgcagcacgagggcagcaataacgctgcctgca
tgcatgcccatgacggaggttgacgttgtctctggttgcatgcgcgaatatggcatgact
agtgtgcttctgagtttaggtagtaatgtgcgtcccaggtattacttgcgtcaggcagaa
gctgcactgcacgctttttttggtgaagtgttgttttctcctgtctaccgcactttggct
gtgggttttgacggtccggatttcctcaatagtgctgccatggtgcataccgctatgccg
ctgtcagatttgcatgcatggttgcatgcgttggaggaacgctatggccgtgatcgcgcc
gtgccgcgttttggtaaccgtacgctggatgtggatgtggtgttctatggtgatctgatc
gtgaaagaaccaggtggggaatactgtattccacgccgtgagttgaagcatagttttgtg
cttaaaccattagtggatgtggcaccggattttgtcgatccagtcagtgggcgtaccttg
gcgcagttgtgggcggtgcatccacacgtcgaggcatgtttccaggtcgtggatcttgaa
gtaccaggtgacgatagagacatgatttag

DBGET integrated database retrieval system