KEGG   Xylella fastidiosa 9a5c: XF1669Help
Entry
XF1669            CDS       T00033                                 

Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xfa  Xylella fastidiosa 9a5c
Brite
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     XF1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604183..1604794
Genome map
AA seq 203 aa AA seqDB search
MRCPHRMIYSRPAHLSRAFFYSKPATAFGRFFAFWSPPMQTIGEEGIALIKFFEGCKLNP
YTCPGGVLTIGYGETGKHVVPDMCLANEQEADAMLRARLAKEFEPAVRRYVRVPLKQQQF
DALVSLSFNIGTGAFHRSTLLKRLNAGDVAGAAEQFGAWKFSSGRVLPGLVRRRKAERWL
FEGQDWQAALAAEHAAVKKASRD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatgccctcatcgaatgatttactcgcgccctgcccacctcagcagggcttttttt
tattcaaaaccagcgaccgccttcgggcggttttttgcgttctggagtccccccatgcag
accattggtgaagaaggcattgcactgatcaaattttttgagggttgcaagttgaacccg
tacacctgtcctggtggagtgttgacgattggctacggcgagacgggcaagcacgttgtg
cctgatatgtgtcttgccaatgagcaggaagccgatgcgatgttacgtgcacgcttagcc
aaagagtttgaaccggcggtgcggcgttatgtgcgtgtgccactgaagcaacagcagttt
gatgcgttggtgtcgttgagcttcaacattggtacgggggcgtttcatcgctcgaccttg
ctaaagcggctcaatgccggtgatgtggctggtgcggcggagcagtttggggcgtggaag
ttttcaagcggtcgtgtgcttcccggcttagttcggcgtcgaaaagccgaacgttggtta
tttgaaggtcaagattggcaggccgcattagcagccgaacatgcggcggtgaagaaggca
tcacgtgattga

DBGET integrated database retrieval system