KEGG   Xylella fastidiosa 9a5c: XF1809Help
Entry
XF1809            CDS       T00033                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XF1809 (recR)
DNA repair and recombination proteins [BR:xfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XF1809 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1722675..1723409
Genome map
AA seq 244 aa AA seqDB search
MRCFIANDACPFCILYPPVVINRVSEFTRLIVGFLGTSWAWDRRHVMSTHLLEQLIDAFR
ILPGVGQKTAQRMAYHVLEREREGGQRLADVLSRAIEKIGHCTECRDFSETKICAICANY
SRDRHQLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLDGIGPHELGLDHLGQRLAAGE
VTELIIATNATVEGETTAHYLALLARQHGIRPSRLAQGLPLGGELEYLDRGTLSHAFGTR
TEVV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatgttttattgcaaacgatgcttgtcctttttgtatcctttatccgcctgtcgta
attaacagagtttcagagtttacccgcttgattgttggcttcttgggcacgtcttgggct
tgggatcgtaggcatgttatgagtacacacttgcttgagcagttaattgatgccttccgt
atcttgccaggtgtcggtcagaagaccgcgcagcgcatggcctaccatgtgctcgaacgc
gagcgtgaaggtgggcagcgcttggctgatgtgctgagccgtgcgattgaaaaaattggt
cattgtacggagtgtcgtgacttcagtgagaccaaaatctgtgcgatctgtgctaactac
agccgtgaccgtcatcagttgtgcgtggtcgagtccccccctgatcggctggcgattgag
caagccactggctatcgtggactatattttattttgcaggggcgcctgtccccgctggat
gggatcggccctcatgaacttgggttggaccatttgggacaacgtcttgctgcaggtgag
gtgacggagctcatcattgcgactaatgcgacggtggagggtgagacgacagcgcactac
ttggcgctcctggcgcgccaacacggcatacgccccagccgactggcacaaggtttgccc
ttgggtggggagctggaatacttagaccgcggcactctttcgcatgcgttcggcacccgt
actgaagtggtttga

DBGET integrated database retrieval system