KEGG   Xylella fastidiosa 9a5c: XF1890Help
Entry
XF1890            CDS       T00033                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xfa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xfa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1797633..1798205)
Genome map
AA seq 190 aa AA seqDB search
MHTHVSHAFASKLSLLSLDRFPMSSIYTFTFTRLDGRPQALADWRGQVLLLVNVASRCGF
TPQYAGLEMLWQRYRDAGLIVIGFPCDQFAGQEPGDEAKIAEFCTLNYGVDFPMAAKIKV
NGADAHPLWQWLKHRRRGLFGMAAIKWNFTKFLIGRNGQPIARYSPIKSPEQLEVHIVRA
LGEEGGGNTH
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcacacacatgtaagccatgcttttgctagcaaactgtcacttctatcgttagatagg
tttcctatgagcagcatctacacattcactttcacacgtcttgacggacggcctcaagca
ttagcagattggcgtggacaagtactgttattggtcaacgtggcgtcgcgttgcggcttt
actccacaatatgctgggttggagatgctatggcaacgttaccgcgatgcaggtttgatt
gttattggctttccatgcgaccaattcgctgggcaggaacctggggatgaggccaaaatt
gctgagttttgcacgctgaactatggggtggatttcccaatggcggcgaagatcaaagtc
aatggagcagatgcacatccactttggcaatggctgaagcatcgccgccgtggtttgttc
ggtatggcagcgattaagtggaacttcactaaatttctgatcggacgcaacgggcaaccc
attgcccgttattcgccaatcaagtcaccggagcaattggaggtgcatatcgttcgtgcc
ttaggggaggaagggggagggaatactcattga

DBGET integrated database retrieval system