KEGG   Xylella fastidiosa 9a5c: XF1893Help
Entry
XF1893            CDS       T00033                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XF1893 (gpmA)
   01230 Biosynthesis of amino acids
    XF1893 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XF1893 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XF1893 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XF1893 (gpmA)
Enzymes [BR:xfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XF1893 (gpmA)
Exosome [BR:xfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XF1893 (gpmA)
  Exosomal proteins of melanoma cells
   XF1893 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801044..1801793
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKEEGLEFDVAHTSLLK
RAIHTLQDALKALDQDWLPIYKSWRLNERHYGALQGLDKIDTAAKHGEEQVNIWRRSYDI
QPPPIDLDDPSHPMRDRRYAALDRKVLPVTESLKNTLERVLPYWNDAIAPQLNDNKTVLI
SAHGNSLRALYKYLNQESDEKILNVNIPTGIPLLFELSDTLQVVSYRYLGDPDAAQRASE
MVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtaaacttgtattgctacgccatggacagagtcaatggaactcaatgaaccgt
tttactggctgggtggatatagggctgaccgaacaaggtcatcaagaagccactatggct
ggtcatctgatgaaagaagaaggactagagtttgatgtcgctcatacttctttacttaag
cgggcgatccatacattacaagacgcacttaaagcattggaccaggactggttaccaatt
tataaaagctggcgtctcaatgagcgtcactacggtgctctacaaggccttgataaaata
gataccgcagctaaacatggtgaagagcaagtcaatatttggcgccgctcctatgacatc
caaccgccgccgattgatctagatgacccaagccatccaatgcgagaccgccgttacgct
gctctggaccgcaaagtattacctgtgacggaatcgctgaaaaacacactcgaacgagta
ttaccgtactggaatgatgccatcgcaccacaactaaatgacaacaagacggtacttatt
agcgcccacggcaactcattgcgtgcgttgtacaagtaccttaatcaagaaagtgatgag
aaaatcctaaatgtcaatatccctactggcattccacttctatttgaactgagcgataca
ctacaagtagtgagttaccgttaccttggtgatccagatgcagcacaacgcgcttccgaa
atggtagcaaaccaaggtaaggcgaagtaa

DBGET integrated database retrieval system