KEGG   Xylella fastidiosa 9a5c: XF1904Help
Entry
XF1904            CDS       T00033                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XF1904 (ruvA)
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XF1904 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1811385..1811969)
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGVLTSKTPPWLVVDVCGVGYELEVPMSTFYELPNVGYEVNLFTHYTQKDDSAAL
YGFLSESERRLFRHLQRVSGIGTKIALAVLSSVSVDTFAGLIQAGDVNALTVIPGIGKKT
AERMLVELRDRAADFNNGISTSGKLNLDTVSEAALALQQLGYKPAEAARMARDAGTESDD
VASVIKKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttacgaggggttttgactagcaaaacgccaccgtggctcgtggttgat
gtgtgtggagttggctacgaactagaggtgccgatgagcactttttacgaattgccaaac
gtcggttacgaggtgaatttgtttactcactatacgcagaaggatgatagtgccgcgttg
tacggttttctgagcgaaagtgagcggcggctattccgccacctgcagcgggtgagtggt
atcggtaccaagatcgctttggcggttctgtccagcgtcagcgtggatacatttgcgggg
ttaatccaggctggtgacgttaatgcattaacggttatcccaggaattgggaagaaaact
gctgaacgtatgctggtggagttgagagaccgtgctgcagacttcaacaatggtatttcc
acctcaggcaagctcaatcttgatacggtgtctgaagctgccttggctttgcagcaactc
ggttacaagccagctgaggctgcacgtatggcacgtgatgctggtactgagagcgatgat
gttgctagtgtcatcaaaaaagcgcttcaagccgcgttacgctga

DBGET integrated database retrieval system