KEGG   Xylella fastidiosa 9a5c: XF2210Help
Entry
XF2210            CDS       T00033                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:xfa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2097597..2098163
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFDDHTPDTPFFVSKEQTQITAELHKIGITFERWEATQAIEPGATPEQVMAAYRA
DIDRLIATHGFKTVDVVSIAPDNPKREEMRAKFLEEHFHKEDEVRFFVAGSGLFTVHSGN
KVYEIECVKNDLIAIPDGTQHWFDMGAAPYFVAIRFFTEPDGWVGHFTGTDIAQRFPRYI
PEGCQSAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactacgcatcttcgacgatcacacccccgatacgccgttcttcgtcagcaag
gagcagacacagatcaccgccgagttgcacaagattggcatcacgttcgagcgctgggaa
gcgactcaagcgattgaacccggtgcaactccagagcaggtcatggcggcctaccgcgct
gatattgatcggctgatcgccacacatggtttcaaaaccgtagacgtggtcagtattgct
ccggacaatcccaagcgcgaagaaatgcgcgccaaatttcttgaggaacattttcacaag
gaagatgaagtccgtttcttcgtcgctggttccggattattcaccgtgcacagcggcaac
aaagtctatgaaatcgaatgcgttaagaacgatttgatcgcaatacccgatggcacccag
cactggtttgatatgggtgccgcgccgtacttcgtcgctatccgctttttcaccgaaccg
gatggctgggtgggccatttcaccggcactgacattgcacaacgattcccccgctatatc
cccgagggctgccaaagcgcgcactga

DBGET integrated database retrieval system