KEGG   Xylella fastidiosa 9a5c: XF2210Help
Entry
XF2210            CDS       T00033                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XF2210
Enzymes [BR:xfa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     XF2210
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     XF2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2097597..2098163
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFDDHTPDTPFFVSKEQTQITAELHKIGITFERWEATQAIEPGATPEQVMAAYRA
DIDRLIATHGFKTVDVVSIAPDNPKREEMRAKFLEEHFHKEDEVRFFVAGSGLFTVHSGN
KVYEIECVKNDLIAIPDGTQHWFDMGAAPYFVAIRFFTEPDGWVGHFTGTDIAQRFPRYI
PEGCQSAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactacgcatcttcgacgatcacacccccgatacgccgttcttcgtcagcaag
gagcagacacagatcaccgccgagttgcacaagattggcatcacgttcgagcgctgggaa
gcgactcaagcgattgaacccggtgcaactccagagcaggtcatggcggcctaccgcgct
gatattgatcggctgatcgccacacatggtttcaaaaccgtagacgtggtcagtattgct
ccggacaatcccaagcgcgaagaaatgcgcgccaaatttcttgaggaacattttcacaag
gaagatgaagtccgtttcttcgtcgctggttccggattattcaccgtgcacagcggcaac
aaagtctatgaaatcgaatgcgttaagaacgatttgatcgcaatacccgatggcacccag
cactggtttgatatgggtgccgcgccgtacttcgtcgctatccgctttttcaccgaaccg
gatggctgggtgggccatttcaccggcactgacattgcacaacgattcccccgctatatc
cccgagggctgccaaagcgcgcactga

DBGET integrated database retrieval system