KEGG   Xylella fastidiosa 9a5c: XF2223Help
Entry
XF2223            CDS       T00033                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XF2223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XF2223
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XF2223
Enzymes [BR:xfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XF2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2109013..2110305)
Genome map
AA seq 430 aa AA seqDB search
MNFHSTRTTAPAATLSQAIAAGLAPDGGLYVPECLPSLGDLDHSADFINTATALLTPFFA
GDPLEVHVPSICAEALDLPAPLLPLATPEDYVLELFHGPTAAFKDFGARFLAACLTRLRR
DAERPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNVHTLR
VAGVFDDCQAMVKQALNDTSLQTAVPLSSANSISLGRLLPQMSYYAHAALTHRASTGRPL
NLIVPTGNLGNALAAILARALGVPLGQIVLATNANHVLPDYFSGAHYRPQPSVATLANAM
DVGAPSNFERLRWLYRGDDAALRAAFTAYSVDDIAIRQTITARHRRYDEIFCPHTATAVF
VLEHLRTQGVAGNWAVVATAHPAKFEQVVEPLIGTTVPVPAALDSLLQRPARDEPLAPEY
PALRHMLLAT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccattccacccgcaccacagcgccggcggccaccctcagccaggcaatcgct
gccggcttagcaccggatggcggcttatatgtccccgagtgcttgccatcccttggtgac
ttggaccacagcgcagatttcatcaacaccgccaccgcactactgacccccttctttgcg
ggcgatccgctggaagtgcatgtaccgtcgatctgtgccgaagcgttggatctccccgca
ccactgctgcccttggccacccctgaagattatgtccttgagttatttcacggccccacc
gctgccttcaaagattttggcgcacgttttctggccgcctgcctgacccggctacgacgt
gatgccgaacgtcccttgacgattctggtggcgacctccggtgatacgggtgctgcggtg
gcggcggcatttcatcggcaacccggattgcgtgtcgtcgtcctgtacccggatggccgt
gtatcgccacgtcaggcccaccaattgggttgttttggcgacaacgtacacaccctgcgt
gtggctggcgtgttcgatgactgccaagccatggtcaagcaggccctgaacgataccagc
ctccaaacagccgtgccgctgagttcggccaacagcatcagcctgggccgcttgctgccg
cagatgagctactacgcccatgcagccttgacccaccgtgccagcacgggccgccctctg
aacctcattgtgcccaccggcaacctcggcaatgccttggccgcgattctggcgcgcgcc
ctgggagtgcccttaggacagattgtgttggcgacaaacgccaaccacgtactccctgat
tacttttccggagcacattaccgcccccagcccagtgtggcgacgttggcgaatgcaatg
gacgttggagcgcccagtaattttgaacgattgcgctggttgtatcgcggcgatgacgcc
gcattgcgtgccgcctttaccgcctattccgtcgacgacatcgcgatccgccagaccatc
accgcacggcatcgtcgctacgacgagatattttgtccccataccgctacggcggtgttt
gtgcttgagcacttgcgtacccagggcgtcgctgggaattgggccgttgtggcaaccgcc
catccagccaaatttgagcaggtggtagaaccgttgatcggtaccaccgtgcccgtgccg
gcggccctggatagcctcctgcaacgtcccgcgcgcgacgaaccgctcgccccagagtac
ccggcattgcggcacatgctgctggccacctaa

DBGET integrated database retrieval system