KEGG   Xylella fastidiosa 9a5c: XF2268Help
Entry
XF2268            CDS       T00033                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xfa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2158482..2160032
Genome map
AA seq 516 aa AA seqDB search
MRCTKTTHPVRIENTALMKKKYILAIDQGTTSSRAILFDQKGHIAGMAQREFTQIFPQPG
WVEHNPRDIMTSVYTTITELLNNTQIDVRAIAGIGITNQRETTVIWDRQTGQPIYNAIVW
QSRQTKDICDQLTTAGYQDLVHAKTGLLIDAYFSGTKVKWILDHVENAHTQATRGELAFG
TIDTWIIWNLTGGQVHVTDYSNASRTLLYDIHALRWDPDLLTMLDIPAAILPDVRSSSDI
YGLTQTPYFHGEQIPIAGIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMHTGKKAVESK
NGLLTTIAWGLNGEIEYALEGSIFVAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVY
VVPAFVGLGAPYWRSDVRGAVFGLTRSTTKEHFIRAALESMAYQTRDVLSAMQADAGMEL
KELRTDGAAITNDFMAQFQSDILAVPVLRSEIAETTALGAAYLAGLATGFWSSREEITQH
WAINLCFKPQMDKQQREHLYAGWKQAVAATLGFRVA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctgcaccaagaccacgcaccctgtccgtatcgaaaacactgcactgatgaaaaaa
aaatacatactggccattgaccaaggcaccaccagctcccgggccattctgtttgaccaa
aaaggccacatcgccgggatggcacagcgggaattcacccagatatttccccaacctggc
tgggtcgaacacaacccgcgcgacatcatgaccagtgtgtacaccacgatcaccgaactg
ctcaacaacacccagattgacgtgcgcgccatcgccggaatcggtattaccaaccaacgc
gaaacaaccgtcatctgggatcgtcagaccggccaaccgatctacaacgcaatcgtttgg
caatcacgccaaaccaaggacatctgcgaccaactcacgaccgccggataccaagatctg
gttcacgccaaaaccggactcctgatcgacgcctatttttcaggcaccaaggtgaaatgg
attctagaccatgtcgaaaacgcacatacacaagcaacacgcggagaattggcattcggc
accatcgacacctggatcatctggaacctaaccggcggccaagtccatgtcaccgattac
agcaacgcctcacgcaccctgctgtacgacatccacgccctgcgttgggatccagacctg
ctgacaatgctcgacataccagcggcgatcctgccggacgtccgttcatccagcgacatt
tacggcctcacccaaaccccgtatttccacggagaacagataccgattgccggaatcgcc
ggtgatcagcaagccgcactcttcggccaagcctgtttcgaacctggcatggccaaaaac
acctacggcaccggctgtttcatgctgatgcacaccggcaaaaaagccgtggaatccaaa
aatggactactcactacgatcgcttggggcctgaatggagaaatcgagtacgcactagaa
ggctcgatcttcgtcgctggctctgtggtgcaatggctgcgcgatggattacgcatgttc
ggcaaagccagcgattcacaagcctacgccgaccgtgtcagcgacaacggcggcgtgtac
gttgtaccggccttcgttggcctgggtgcgccctactggcgcagcgatgtccgtggcgca
gtgttcggactgacacgcagcaccaccaaggaacacttcatccgtgccgcactagaatca
atggcctaccaaacccgcgacgtcctgagcgcaatgcaggcagatgcaggcatggaactc
aaagagctacgcactgacggcgcggcaatcaccaatgacttcatggcccaattccagagc
gatatcctcgccgtgccggtgctgcgctcggagatcgccgaaaccacagcactcggtgcc
gcctacctggctggacttgcaaccggattttggtccagccgcgaagagattacgcaacac
tgggccatcaatctctgcttcaagccgcagatggacaagcaacaacgcgagcacctatac
gcaggctggaaacaggccgtcgcagccaccttaggcttccgtgtggcctga

DBGET integrated database retrieval system