KEGG   Xylella fastidiosa 9a5c: XF2270Help
Entry
XF2270            CDS       T00033                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XF2270
Enzymes [BR:xfa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XF2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2161322..2162188
Genome map
AA seq 288 aa AA seqDB search
MFDIPGLSTGDFHGFPSLLIQTPFSHAAISLFGGQLLSFVPSGGEEVIWLSPLVQPPPTA
IRGGIPICWPYFGRQGQRDTMPAHGFVRTVPWQQVESCQENDGSLFLVLAPPPLKHLGLH
LRMTLRIGRTLEQELATENISHAPISFTQALHNYFRVSNALQVTVQGLDGVEYLDKFEGY
TQRHRQQGHWTLQDPRDPGRADRIYVDTSGHYVLVDPLFSRRIVLTTEGSHSLVVWNPGH
AGASNMIDVADGWRDYLCLEPANAGPDEIELLPGARHVLRQSIAIAPL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacatccccggcctgagcacaggtgatttccatggtttcccctcactcctgata
cagaccccgttctcacatgcggcgatcagtctgtttggcgggcagttgctttccttcgta
ccaagcggtggagaagaggtcatatggctctcccccctggtccaaccaccacccaccgca
atccgcggtggtatccccatctgttggccttactttggccgccaagggcaacgcgacacc
atgcctgcgcatgggttcgtgcgtactgtgccatggcaacaagtggagagctgccaagaa
aacgatggaagtctgtttctcgtcctggcgccgccaccgctcaaacacctggggttgcat
ctgcggatgacactgcgtatcggccgcaccctggaacaagagttagccaccgagaacatc
agccacgctccgatcagcttcacccaagcgctgcacaactatttcagagtcagcaacgca
ctacaggtcacggttcaaggactggatggagtggaatatctggacaaattcgagggctat
acccaacgccaccgccaacagggccattggaccttgcaagatccacgtgatcccggccgt
gcggatcgtatctacgtcgacaccagcggccattatgtgctggtcgatccattattttcc
cgacgcatcgtgctgacgacggaaggcagccacagcctggtggtatggaatccaggtcac
gccggtgcaagcaacatgattgatgtcgccgacggctggcgcgactatctctgcctggaa
ccagccaatgcaggaccagatgaaatcgaactgctccccggagcacgccatgtgctgcgc
cagagcatcgccattgcaccactgtag

DBGET integrated database retrieval system