KEGG   Xylella fastidiosa 9a5c: XF2314Help
Entry
XF2314            CDS       T00033                                 

Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xfa  Xylella fastidiosa 9a5c
Brite
Enzymes [BR:xfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     XF2314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2197984..2198532
Genome map
AA seq 182 aa AA seqDB search
MAQTAFGRFFAFWSPPMQTIGEEGIALIKFFEGCKLNPYTCPGGVLTIGYGETGKHVRPD
MRLANEQEADARLRARLAKEFEPAVRRYVRVPLKQQQFDALVSLSFNIGTGAFHRSTLLR
KLNAGDVAGAAEQFHVWKWAGGSIQSGLIIRRAAERALFEGGDWRAEAEKQRAALKSKGR
RG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttggctcagaccgccttcgggcggttttttgcgttctggagtccccccatgcagaccatt
ggcgaagaaggcattgcactcatcaagttttttgagggttgcaagttgaacccgtacacg
tgtcctgggggagtattgaccattggctacggcgagacgggcaagcatgttaggcctgat
atgcgtcttgccaatgagcaggaagccgatgcgcggttacgtgctcgattagccaaagag
tttgaaccggctgtacggcgttatgtgcgtgtgccactcaagcaacagcagtttgatgcg
ttggtgtcgttgagcttcaacattggtacgggtgcgttccaccgctcgacgctgttacgc
aagctcaatgccggtgatgtggctggtgcggcggagcagtttcatgtgtggaaatgggcg
gggggcagtatccagtcgggtttaatcatcagacgtgccgccgaacgtgcattgttcgaa
ggcggtgactggcgtgctgaagcggagaaacagcgtgccgctttgaagagcaagggccgc
cgtggttga

DBGET integrated database retrieval system