KEGG   Xylella fastidiosa 9a5c: XF2331Help
Entry
XF2331            CDS       T00033                                 

Definition
dihydrofolate reductase type III
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xfa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:xfa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2212193..2212759)
Genome map
AA seq 188 aa AA seqDB search
MDTHLKKARENNEYLQRVVRSAMIVSLIAALDRYRAIGRDNGLPWHLPDDLKRFKALTLG
RPVLMGRKTAHSLGRPLPGRTNLVLTRSGHVPFSEMRAVDSLDVAIVQAAAEGADTLSVI
GGGELYALTLPHANAMYLTHVDVAVAGADAYFPMFDAVDWEIKKREPHQDDGRHAYPFTF
IDYCRRLR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgcatctcaagaaagccagagaaaataatgaatatctacaacgtgttgtacgt
agtgccatgattgtttccttaattgcggcgttggatcgttaccgcgccattggtcgtgat
aatgggttgccgtggcacttgccggacgatctgaagcgtttcaaagcattgactttaggt
cgaccggtgctgatgggacgcaagactgcgcattcccttgggcgtcccttaccagggaga
accaatctggtattgacgcgttctggacacgtgccattttctgaaatgcgggcggtggat
tcgcttgatgtagcgatcgtccaggcggctgcagagggtgccgacacgttaagtgtgatt
ggtggaggtgaactgtatgcactgactttgccgcacgccaatgcgatgtacttaactcac
gtggatgtggccgttgcgggcgctgacgcgtattttcctatgttcgacgccgtcgattgg
gagatcaagaagcgtgaaccccatcaggacgatgggcgtcatgcctacccgttcaccttc
atagactattgccgccgattgcgttag

DBGET integrated database retrieval system