KEGG   Xylella fastidiosa 9a5c: XF2585Help
Entry
XF2585            CDS       T00033                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xfa  Xylella fastidiosa 9a5c
Brite
Enzymes [BR:xfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XF2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2463660..2464316
Genome map
AA seq 218 aa AA seqDB search
MTIDFSIAREKMVEQQIRPWDVVDLHVLDVLAHIPREAFVPEPYRTLAYADLEIPLHGGQ
TMMKPVIEGRLLQALMLSPEEDVLEIGTGSGFLTACLASLGHEIVSLEINSALGASAHTH
LDTIGLGSNVHIEQADAFTWQPERQFSVICLTGAVNTLPLQFLQWLHPNGRMFAIHGHSP
AMQAVLVRGDASTPNITSLFETDLAYLKGGEPALQFHF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgatttttccatagcccgcgaaaaaatggtcgaacagcagatccgtccatgg
gatgtggtggatctgcacgtacttgatgtactggcacacatcccacgcgaggcgttcgtc
cctgaaccataccgtaccctagcctacgcagaccttgaaatccccttacacggcggacaa
acaatgatgaaacccgtcattgaggggcgcctgcttcaggccctgatgttgtcaccagaa
gaggacgtattggaaatcggcaccggcagtggcttcctcactgcctgcctggcctcgctg
ggacacgaaatagtcagcctagaaatcaattccgcactgggcgcatcggcacatacccac
ctagataccattggcctaggcagtaacgtacacattgagcaagccgacgctttcacttgg
caacccgaacgtcagttcagcgtcatttgcctgactggtgcagtgaacacgctgccactg
caatttctgcaatggctacaccccaacggccgtatgttcgctatacacggccactccccg
gcgatgcaagctgtcctggtgcgtggagatgcctctaccccaaacatcacatccctgttc
gagaccgatctggcttacctcaaaggtggcgagccagccctccaatttcatttttga

DBGET integrated database retrieval system