KEGG   Xylella fastidiosa 9a5c: XF2606Help
Entry
XF2606            CDS       T00033                                 

Definition
pseudouridylate synthase
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
xfa  Xylella fastidiosa 9a5c
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2485339..2486331)
Genome map
AA seq 330 aa AA seqDB search
MTDPFRSQSESVVECFSVRIVVVPAEHSGQRLDNFLLSKLKGVPRSLIYKLVRSGQVRVN
GGRVKAERKLDGGDEIRLPPLRLIQDRAIVAPSAAFLARMEAAIVFEDARLLALNKPSGM
ASHGGSGISYGVIEAMRILRPKQELELVHRLDRDTSGLLIMAKKRAALIELQALMREASV
NGKEGRGIAKRYLTLLSGRMPNGVMSVDAPLHINLRQGGERHVRVHHDGKPSKSRFRLLE
RRGGQSYCEVLIETGRTHQIRVHAQHLGHPVTGDDKYGDQEVNRRLRDQIGLQRLFLHAV
SLEFALDAGSTPYVLNAPLAEDLVAALDRL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccatttcgttcccagtcagagtctgtcgtggagtgtttcagcgtacgtatc
gttgtcgtgcctgccgagcacagtgggcagcgcttggataattttcttctcagcaaacta
aagggtgtcccgcgcagcttgatttacaagctggtgcgcagtgggcaagtgagagtgaat
ggtggtcgtgtcaaggccgagcgcaaattggatgggggggacgaaatccgacttccgccg
ctacgtcttattcaggatcgggccattgtcgcgccatcggctgcatttctggccaggatg
gaggcggcgattgtgttcgaggacgcgcgtttgttggcgttgaacaaacccagtggtatg
gctagccatggcggcagtgggatcagttacggcgtgattgaggctatgcgtatcttgcgt
cctaagcaggaactggaacttgtgcatcgtttggatcgtgatacctctggtttgttgatc
atggcaaaaaagcgtgcagctctcattgagttgcaggcattgatgcgtgaagccagcgtg
aatggtaaggaggggcgtggtatcgccaagcgctatttgactctgttatccgggcgtatg
cccaatggagtgatgagtgttgatgcgccgttgcatattaatttgcgccaggggggagag
cgtcatgtccgggtgcatcatgatgggaagccttcaaagagtcgtttccgtttgctagag
cggcgtggagggcaatcgtattgcgaggtgttgatcgaaaccggtcgaactcatcagatt
cgtgtgcatgcacagcatctcggtcatccagtcactggggatgacaaatacggtgatcag
gaggtcaaccggcggttgcgcgatcagattggtttacagcgtcttttcttacatgctgtg
tcgttggagtttgctttggatgctggaagtacgccctatgtgttgaatgctccattggcg
gaggacttggtggccgccttagaccgtctttag

DBGET integrated database retrieval system