KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_00415Help
Entry
XFLM_00415        CDS       T01979                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XFLM_00415
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XFLM_00415
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XFLM_00415
Enzymes [BR:xff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XFLM_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(88112..89404)
Genome map
AA seq 430 aa AA seqDB search
MNFHSTRTTAPVTTLSQAIAAGLAPDGGLYVPECLPPLGDLDHSADLINTATALLTPFFA
GDPLEVHVPSICAEALDLPAPLLPLATPEDYVLELFHGPTAAFKDFGARFLAACLTRLRR
DAERPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIHTLR
VAGVFDDCQAMVKQALNDTSLQTAVPLSSANSISLGRLLPQMSYYAHAALTHRASTGRPL
NLIVPTGNLGNALAAILARALGVPLGQIVLATNANHVLPDYFSGAHYRPQPSVATLANAM
DVGAPSNFERLRWLYRGDDAALRAAFTAYSVDDTAIRQTITARHRRYDEIFCPHTATAVF
VLEHLRAQGVAGDWAVVATAHPAKFEQVVEPLIGTTVPVPAALDSLLQRPARDEPLAPEY
PALRHMLLAT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccattccacccgcaccacagctccggtgaccaccctcagccaggcaatcgct
gcaggcttagcaccggatggcggcttatatgtccccgagtgcttgccaccccttggtgac
ttggaccacagcgcagatttaatcaacaccgccaccgcactactgacccccttctttgcg
ggggatccgctagaagtgcatgtgccgtcgatctgtgccgaagcgctggatctccccgca
ccactgctgcccttggctacccctgaagattatgtccttgagttatttcacggccccact
gctgccttcaaggattttggcgcacgttttctagcggcctgcctgactcggctacgacgt
gatgccgaacgtcccttgacgattctggtggctacctccggtgatacgggtgctgcggtg
gcggcggcatttcatcggcaacccggattgcgtgtcgtcgttctgtacccggatggccgt
gtatcgccacgtcaggcccaccaattgggttgttttggcgacaacatacatacactgcgt
gtggctggcgtgttcgatgactgccaagccatggtcaagcaggccctgaacgataccagc
ctccaaacagccgtgccgctgagttcggccaacagcatcagcctgggccgcttgctgccg
cagatgagctactacgcccatgcagccttgacccaccgtgccagcacgggccgccctctg
aacctcattgtgcccaccggcaacctcggcaatgccttggccgcgattctggcgcgcgcc
ctgggagtacccttaggacagattgtgttggcgacaaacgccaaccacgtactccctgat
tacttttccggagcacattaccgcccccagcccagtgtggcgacgttggccaatgcaatg
gacgttggagcgcccagtaattttgaacgattgcgctggttgtatcgcggcgatgacgcc
gcattgcgtgccgcctttaccgcctattccgtcgacgacaccgcgatccgccagaccatc
accgcacggcatcgtcgctacgacgagatattttgtccccataccgctacggcggtgttt
gtgcttgagcacttgcgtgcacagggcgtcgctggggattgggccgttgtggcgaccgcg
catccagccaaatttgagcaggtggtagaaccgttgatcggtaccaccgtgcccgtgccg
gcggccctggatagcctcctgcaacgtcccgcgcgcgacgaaccgcttgccccagagtac
ccggcattgcggcacatgctactggccacctaa

DBGET integrated database retrieval system