KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_00430Help
Entry
XFLM_00430        CDS       T01979                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xff00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xff00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(93420..94358)
Genome map
AA seq 312 aa AA seqDB search
MQFDSNGRLRHLLTLEGLSRHTLLQLLDCAAQNCALGVDPMGKRNVLAGMAVCTLFFEPS
TRTRHSFHLAAQRLGADVLNFDASMSSTSKGESACDTLKNLEAMGVRGFIVRHPEEIVIA
QLAAVVGEGTVLINAGAGRSTHPTQGLLDMLTLCQAKGNDFSKLKLLFVGDIKHSRVARS
NLHALRTLGAGQIRVCGPTALLPHDGLLSGCVVSQDFDAMLEGVDVLMMLRLQRERMEEG
LVPSLEHYHANYGLTAARLARAAPDAVVLHPGPINRGVEITDEVADGPQSWILRQASNGV
MVRMAVLETLLG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgattcaaatggacgtttgcgtcacctgctcactttggaaggactgtcgcgt
cacacactgctgcagttacttgactgtgctgcccagaactgtgcactcggggttgaccct
atgggcaagcgcaacgtgttagctggtatggcagtatgcacactcttttttgaaccatcc
acgcgtacccgtcattcattccacctggccgcgcagcgtttgggagcggatgtattaaat
ttcgatgcttcgatgtcgtctacgagcaagggtgagagtgcctgcgacacattgaagaat
ttggaggcaatgggggtgcgcggttttatagtgcgccatcctgaagagatcgtcatcgca
cagttggctgcagtcgttggtgagggtaccgtgctgatcaatgccggtgctggccgtagt
acccatccgacgcaggggctgctggatatgctgaccttatgtcaggccaagggcaacgat
ttttccaagctaaagctactctttgtcggtgacatcaaacattcacgcgttgcacgctcc
aacctgcatgcgttgcgcaccctgggtgcaggacagatccgggtgtgcggtccgactgca
ttattgccccatgacggcctcctctctggttgtgttgtcagtcaagattttgatgccatg
cttgaaggtgtggatgtactgatgatgctgcgtctacagcgtgagcgtatggaggaagga
ttggtgccctcgttggagcactaccatgccaactatggtttgaccgcagcgcgcctggcg
cgtgcagctccggatgcggtggtattacatcctgggccaatcaaccgcggcgtggagatt
accgatgaggtggccgatggcccgcagtcatggatcctgcgtcaagccagcaatggcgtg
atggtccgtatggccgtgctggagacgttactgggttga

DBGET integrated database retrieval system