KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_00570Help
Entry
XFLM_00570        CDS       T01979                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00010  Glycolysis / Gluconeogenesis
xff00620  Pyruvate metabolism
xff00640  Propanoate metabolism
xff00680  Methane metabolism
xff01100  Metabolic pathways
xff01110  Biosynthesis of secondary metabolites
xff01120  Microbial metabolism in diverse environments
xff01130  Biosynthesis of antibiotics
xff01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFLM_00570
   00620 Pyruvate metabolism
    XFLM_00570
   00640 Propanoate metabolism
    XFLM_00570
  Energy metabolism
   00680 Methane metabolism
    XFLM_00570
Enzymes [BR:xff01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XFLM_00570
Lipid biosynthesis proteins [BR:xff01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XFLM_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADN62138
Position
123263..125206
Genome map
AA seq 647 aa AA seqDB search
MSDLYTIDPMLAKDAHIDRAHYKTLYHESIEQPEAFWNKVSQRLEWFKAPTKIKNVSYQL
EDVHIRWFEDGELNASVNCLDRHLTLRGDKTALLFEPDAPDAPSSRITYRELYERVCQLG
NALRHLGIEKGDRVTIYLPMIPDAVVAILACARIGAIHSVVFGGFAANSIADRVNDCGSK
LIITADEGLRGGRKIPLKANVDAALKIHGTQSVETVLVVRHTGSTINMHTPRDRWFHDLV
DIQATECAPERMNAEDSLFILYTSGSTGKPKGVLHTTGGYLVYTSYTHETVFDLRENDIY
WCTADIGWITGHSYIVYGPLANGTTVLLFEGTPHYPTVSRFWEVIDKHHVTLFYTAPTAI
RALMREGDTPVKKTSRKSLRLLGSVGEPINPEAWHWYYTIVGNGRCPIVDTWWQTETGGI
LITPLIGATDLKPGSVTLPFFGIRPALVDTNGQTLDGPAAGNLVLLDSWPGQMRTLYGDH
QRFIDTYFRTYPNTYFTGDGCRRDADGYYWITGRVDDVINISGHRIGTAEIESTLVAHPK
VAEAAVVGFPHPIKGQGIYAYVTLITGETPSEALHQELLTWVRKEIGAIAIPDHVQWASN
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSIVDLLLNERLKH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgtacaccattgatccgatgttggccaaagatgcgcacatagaccgtgcg
cactacaaaacgctttaccacgaatccatcgaacaaccagaagcattctggaacaaagtc
tcacagcgcctggagtggtttaaagcgccgaccaaaatcaaaaatgtcagctaccaactg
gaagatgttcacatccgttggttcgaagacggtgaactcaatgccagcgtcaactgcctg
gaccgccatctcaccttacgtggcgacaaaacagcactcctgtttgaacctgacgcccca
gacgccccatcctcacgcatcacctaccgtgaactatacgagcgcgtctgccaactcggt
aacgcactgcgtcacctcggcatcgaaaagggcgaccgcgtcaccatctacttaccaatg
attccagatgcagtcgtcgccatcctcgcttgcgcacgcattggagcaatccactccgtc
gtcttcggcggttttgcagcaaactccattgccgaccgagtgaatgactgcggtagcaaa
ctcatcatcaccgcagatgaaggcctgcgtggtggcagaaaaattccattgaaagccaat
gtcgatgccgcattaaaaatccacggaacccagtccgtcgaaaccgtactcgtcgtgcgt
cacaccggcagtacgatcaacatgcataccccgcgcgaccgctggttccatgacctcgtc
gacatccaagcaaccgaatgcgccccagaacgcatgaacgctgaagactcccttttcatc
ctctatacctccggctccacaggcaaacccaaaggagtcctgcacaccaccggcggctac
ctggtgtacaccagctacactcatgaaaccgtgtttgacctacgcgaaaacgacatctac
tggtgcactgccgacatcggctggattactggtcacagctacatcgtttacggcccccta
gccaatggcaccaccgtcttgctgtttgaaggcaccccccactacccaaccgtgtcgcgc
ttctgggaagtgatcgacaaacatcacgtcaccctcttctacaccgcgccgaccgcaatc
cgtgcattgatgcgcgaaggcgacactcctgtaaaaaaaacctcccgcaaaagcttgcgg
ttacttggcagcgttggcgaacccatcaaccccgaagcctggcactggtactacaccatc
gttggcaacggacgttgtcccattgtcgacacctggtggcaaaccgagacaggaggaatc
ctcatcaccccactgatcggtgcaaccgaccttaaaccaggctcagtcaccctccccttc
ttcggcatacgccccgccctagtggataccaacggacaaacactggatggccccgcagca
ggtaacctagtcctgctcgattcctggccgggtcaaatgcgtaccctctacggtgaccac
caacgttttatagacacttactttcgcacctaccccaatacttacttcaccggcgacggc
tgccgccgcgatgccgacggctattactggatcactggacgtgttgatgacgtcatcaac
atctccggccatcgcatcggcaccgccgaaatcgaaagcacactcgtcgctcaccccaaa
gtggctgaagccgcggtcgtcggcttccctcacccgatcaaaggccagggcatctacgca
tacgtgacattaattaccggcgagacacccagcgaagcactgcaccaagaactgctcacc
tgggtacgcaaagaaatcggagcaatcgccatacccgatcacgtgcaatgggcatccaac
ctccccaaaacccgctccggaaagatcatgcgccgcatcctgcgcaaaattgcagaaaac
gcaccagaccaactcggtgacacctccacactagctgatccgtctatcgtcgacttattg
ctcaacgaacgactgaaacactga

DBGET integrated database retrieval system