KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_00625Help
Entry
XFLM_00625        CDS       T01979                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xff00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140457..141323
Genome map
AA seq 288 aa AA seqDB search
MFDIPGLSTGDFHGFPSLLIQTPFSHAAISLFGGQLLSFVPSGGEEVMWLSPLVQPPPTA
IRGGIPVCWPYFGRQGQRDTMPAHGFVRTVPWQQVESCQENDGSLFLVMAPPPLKHLGLH
LRMTLRIGRTLEQELATENISHAPISFTQALHNYFRVSNALQVTVQGLDGVEYLDKFEGY
TQRHRQQGHWTLQDPHDPGRADRIYVDTSGHYVLVDPLFSRRIVLTTEGSHSLVVWNPGH
AGASNMIDVADGWRDYLCLEPANAGPDEIELLPGARHVLRQSIAIAPL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacatccccggcctgagcacaggtgatttccatggtttcccctcactgctgata
cagaccccgttctcacatgcagcgatcagtctgtttggcgggcagttgctttcatttgta
ccgagcggtggagaagaagtcatgtggctatcccccctggtccagccaccacccactgca
atccgcggcggtatcccagtctgttggccttactttggccgccaagggcaacgcgacacc
atgcccgcgcatgggttcgtgcgtactgtgccatggcaacaagtggagagctgccaagaa
aacgatggaagtctgtttctcgtcatggcaccgccaccactcaaacacctggggttgcat
ctgcggatgacactgcgtatcggccgcaccctggaacaagagttagccaccgagaacatc
agccacgctccgatcagcttcacccaagcgctgcacaactatttcagagtcagcaacgca
ctacaggtcacggtccaaggactggatggagtggaatatctggacaaattcgagggctat
acccaacgccaccgccaacagggccattggaccttacaagatccacatgatcctggccgt
gcggatcgtatctacgtcgacaccagcggccattatgtgctggtcgatccattattttcc
cggcgcatcgtgctgacgacggaaggcagccacagcctggtggtgtggaatccaggtcac
gctggtgcaagcaacatgattgatgtcgccgacggctggcgcgactatctctgcctggaa
ccagctaatgcaggaccagatgaaatcgaactgctccccggagcacgccatgtgctgcgc
cagagcatcgccatcgcaccactgtag

DBGET integrated database retrieval system