KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_00935Help
Entry
XFLM_00935        CDS       T01979                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFLM_00935
   00670 One carbon pool by folate
    XFLM_00935
Enzymes [BR:xff01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     XFLM_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193366..193932)
Genome map
AA seq 188 aa AA seqDB search
METHLKKARENNEYLQRVVRSAMIVSLIAALDRYRAIGRDNGLPWHLPDDLKRFKALTLG
RPVLMGRKTAHSLGRPLPGRTNLVLTRSGHVPFSEMRAVDSLDAAIVQAAAEGADTLSVI
GGGELYALTLPHANAMYLTHVDVAVAGADTYFPMFDAVDWEIKNREPHQGDGRHAYPFTF
IDYCRRLR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgcatctcaagaaagccagagaaaataatgaatatctacaacgtgttgtacgt
agtgccatgattgtttccttaattgcggcgttggatcgttaccgcgccattggtcgtgat
aatgggttgccgtggcacttgccggacgatctgaagcgtttcaaagcattgactttaggt
cgaccggtgctgatgggacgcaagactgcgcattcccttggacgtcccttaccagggaga
accaatctggtattgacgcgttctggacacgtgccattttctgaaatgcgggcggtggat
tcgcttgatgcagctatcgtccaggcggctgcggagggtgccgacacgttaagtgtgatt
ggtggaggtgaactgtatgcactgactttgccgcacgccaatgcgatgtacttaactcac
gtggatgtggctgttgcgggcgctgacacgtattttcctatgttcgacgccgtcgattgg
gagatcaagaaccgtgaaccccatcagggcgatgggcgtcatgcctacccgttcaccttc
atagactattgccgccgattgcgttag

DBGET integrated database retrieval system