KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_01440Help
Entry
XFLM_01440        CDS       T01979                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XFLM_01440
   00052 Galactose metabolism
    XFLM_01440
   00500 Starch and sucrose metabolism
    XFLM_01440
   00520 Amino sugar and nucleotide sugar metabolism
    XFLM_01440
Enzymes [BR:xff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XFLM_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(297914..298804)
Genome map
AA seq 296 aa AA seqDB search
MIKRIRKAVFPVAGLGTRFLPATKTIPKEMLPIIDKPLIQYAVDEAIQAGCDTLVFVTNR
YKHAVADYFDKAYELEQKLERAGKYEQLELVRHVLPDGVRTVFVTQTEALGLGHAVLCAK
PVVGDEPFAVLLPDDLMWSRNGGALKQMADVAEVSGSSVIAVEDVPVDKTVNYGIVGTDV
FDGCKGRITQIVEKPKPDDAPSNLAVVGRYVLSGKIFEMLENTSIGTGGEIQLTDAIAEL
LKYERVDAYRFQGRRFDCGAHIGLIEATLHLALEHKKHGQAVREILRDTLLTVDKR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtattcgcaaggctgttttccctgtggccggtcttggtacacgttttttg
ccagcgaccaaaaccatccccaaggaaatgctgccaattattgataaacccctcatccag
tacgcggttgacgaagcgatccaggctggatgcgatacccttgtgtttgtgaccaaccgt
tacaagcatgcggtggccgattacttcgacaaagcgtatgaattggagcagaagcttgag
cgtgccggtaaatatgagcagctggaattagtgcgtcatgtgttgcctgatggagtgcgt
acggttttcgtgactcaaactgaagcgctgggtctaggccatgcagtgttgtgcgccaag
cctgtggtgggtgatgaaccatttgcggtgttgctgccagacgatctcatgtggagtcgt
aatggaggtgcactgaaacaaatggctgatgttgctgaagtctccggtagcagtgtcatt
gcagtagaggatgtccccgtcgataaaaccgttaactatggcatcgtcggaacggatgtg
tttgatggatgcaagggccgcattactcaaatcgtcgaaaagcctaagcccgacgatgca
ccgagcaatcttgctgtggtggggcgctatgtcctgagtggcaagatattcgagatgctt
gaaaacacctctatcggtactggcggcgagattcaattgactgatgcgatcgctgaatta
ctgaaatacgagagagtggatgcataccgcttccaaggtcgccgatttgattgtggtgca
cacattggtctgattgaggctaccctgcatttagcccttgaacacaagaaacatggtcag
gcggtgcgtgagatcctgcgtgacacattacttacggtcgacaagagataa

DBGET integrated database retrieval system