KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_01780Help
Entry
XFLM_01780        CDS       T01979                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFLM_01780
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XFLM_01780
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XFLM_01780
Enzymes [BR:xff01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XFLM_01780
Exosome [BR:xff04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XFLM_01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(367942..369531)
Genome map
AA seq 529 aa AA seqDB search
MTPPAAETPQWWYQSGATRAAANGAMAGKAKNVILFLGDGMSFTTVAAARILEGQRNAAT
GEENVLSWEHFPATAFSKTYNTDAQTADSAGSMTAITSGVKTHRGAIGVSAGQRNDCVDS
LGKSLLTWLTLADSAGMATGIITTTRITHATPAALYAHTPERHWESDANLPEAAKAGGCR
DIAQQLLTSTRYGRGPLVVLGGGRAQFMPAHQHDPEYAERTGLRLDGRDLIEEWKRAHPN
GAYVWNTHQFNADAGAPALLGLFEPSHMQFEHDRDRHPNGEPSLAEMTRTAIQSLSRDPH
GFVLMVEGGRIDHAHHAGNAYRALDETIALSDAVRAAVQTAPKDTLIIVTADHAHTLNFV
GYPVRGNPILGKVRSSSRDAGDRTQYAHDLNALPYTTLTYANGPGHTAASNTQSAGTKHF
NHQPSTYELVRGRPDLTTIDTQAPDYLQEALVPLKKESHSGEDVGIWATGPGSAAFRGVL
EQHVIYHVIVQATPALRQRLCAAGTCNAAGVPIKLPQLADFERKDQSRE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctcctgccgctgagaccccgcaatggtggtatcagagcggcgctacacgtgct
gcggctaacggtgccatggctggcaaagccaaaaacgtcatcctatttctcggcgacggc
atgagcttcaccaccgtagccgctgcacgcatcctggaaggccagcgcaacgctgccact
ggcgaagagaacgtattgtcctgggagcattttcctgccaccgcattcagcaaaacctac
aacaccgatgcccagaccgcagactcagccggttccatgaccgcgatcacctctggagta
aagacccacaggggcgcgatcggcgtcagtgcaggtcagcgcaacgactgcgttgatagc
ctcggcaaaagtctacttacctggctgacactggcagacagtgccggtatggcgaccggc
atcataacgaccacccgtatcactcacgccaccccggcggcgctctacgcacataccccg
gaacgtcattgggaaagtgatgccaacctgcctgaagccgccaaagcgggcggctgccgc
gatattgcccaacaactcctcacctctacccgctatgggcgtggtcctctggtggtgctg
ggtggtggtcgcgcccaattcatgcctgcgcaccaacatgaccccgaatatgctgagcgt
actggcttacgtttggatggacgcgacctcattgaagaatggaaacgtgcacatcccaat
ggtgcttatgtgtggaacacccaccaattcaacgctgatgctggcgcaccggccctgctg
ggtttatttgagcccagccatatgcagtttgaacacgatcgcgaccgacaccccaacggc
gagcctagcttggccgagatgacacgtaccgcgatccaatcgctgtctcgtgatccacat
ggttttgtactgatggttgaaggaggccggattgatcacgcccatcatgccggtaacgcc
tacagagccttggatgaaaccatcgcactctcagatgcagtacgcgccgccgtacagaca
gcccctaaagataccttgattattgtcactgccgaccatgcccatacccttaactttgtt
ggctacccagtccgcggcaaccccatattgggcaaagtgcgtagcagcagccgtgatgca
ggagaccgcacccagtacgcacatgatttaaatgccttgccctataccacattgacttac
gcaaacggtcctggccacaccgccgccagcaatacacagtcggctggaaccaaacacttc
aaccatcaacccagtacctatgaattagtccgtggtcgcccagatctgaccacgatcgac
acccaagcgcccgactatctgcaagaagcactggtcccactgaagaaggagagccacagc
ggcgaagacgtcggcatctgggccacaggccccggcagtgctgcgttccgcggcgtcctt
gaacaacatgtcatctaccatgtcatcgtccaagcgacacccgcattacgccagcgcctg
tgtgccgctggcacatgtaacgccgctggcgtgccgatcaagttgccacagctggccgac
ttcgaacgcaaagaccagagcagggagtga

DBGET integrated database retrieval system