KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_02540Help
Entry
XFLM_02540        CDS       T01979                                 

Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xff00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XFLM_02540
Enzymes [BR:xff01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XFLM_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(519341..521260)
Genome map
AA seq 639 aa AA seqDB search
MSLLAALNQAGVLRTLDDALARSLCRLDPKTPDKVAAAAALASMAVAHGHAGVDLAHPGL
LAGEMFDWPSAAEWVHLLRASRWVAEPSEGEAPAPTGQPLVLEQGVLYLRRYREYERRLA
IGLRRIAAARLPPAESAAVATVFAALFPQARAGQDRQALAAALALQRALLLVTGGPGTGK
TTTIARLLLLRVAQARQQGQASLRIALAAPTGRAAERMAESLRAAAGHVSAAGGDAALFA
ALPSGASTVHRLLGVIPDTPRFRHCEDNPLPYDVIVVDEASMMDLPLMCKLVDAVADGTQ
LILLGDPDQLPSVEAGDVLAGILAAAGSGEVLDVADAQVLAPLLGAPSAAVVAECHVVRG
GLHGHRVHLQHSHRQGEDLALAPLAEAVRLGDATAVLGMLRRGTLRGVQFHEGVLDPCVG
AGQVLLAHWRALAALSDPVQALAAAGRLRLLTALREGPQGAAGINARIERLLGGGGVDGY
FHGRLLLMTETSSRQRLFNGDIGVCLRDDDGTMWAWFSGAGGEGVRAFAPAALPAHESAF
AMTVHKAQGSEFDTVWLQLPRQESRVLSRELIYTGLTRARHGLHVAGSESVLCAALARQA
VRVSGLAWRLGVTGCNTVPIGAGAGDAEVFGKGGQGVLF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgccgcgctcaaccaggctggtgtgttgcgtacgttggatgatgcgttg
gcgcggagtttgtgccgtcttgatccgaagactccggacaaggtggccgctgccgctgcg
ctggcctcaatggcggtggcgcatggtcacgcgggtgtagatctggcccatcctggattg
ctcgctggagagatgttcgactggccttccgctgcggagtgggtgcatctgctgcgcgcc
agtcggtgggtggccgagccatctgagggggaggcaccagcaccgacagggcagccgttg
gtgcttgagcaaggggtgctctatctgcgtcgctatcgtgagtatgagcggcgtttagcg
atcggtttgcgtcggattgccgctgcacggttgccaccggctgaatcggccgcggtggcg
acggtgtttgcggcgttgtttccacaggcacgcgctgggcaggatcgtcaggcattggcg
gctgcgttggcgttgcagcgtgcgttattgctggtcacgggggggcctgggactggcaag
acaacgacgattgcgcgcctgttattgctgcgtgtcgcccaggcgcggcaacaggggcag
gcgtcgttacgtattgcgctggccgcgccgacgggccgtgcggccgagcgaatggctgaa
agtctgcgtgcggcggcagggcatgtgtccgcggcggggggggatgcggcgttgtttgcc
gcgttgccgtcgggagcgagtacggtgcatcgtttgcttggggtgatccccgatacgccg
cgctttcgtcattgtgaggacaatccgttgccttatgacgtgatcgtggtggatgaggct
tcaatgatggatctgccgctgatgtgtaagttggtggatgctgtggcggacgggacgcag
ttgattttgctgggtgatccggatcagttgccgtcagtggaggcgggcgatgtgcttgcg
gggattcttgccgctgccggttccggtgaggtgttggatgtcgccgatgcgcaggtattg
gcgcccttgttaggcgcgccgtctgcagcggttgttgcagagtgtcacgttgtccgcggg
gggttacatgggcatcgggtgcatctgcaacacagtcaccgtcagggtgaggatttagcg
ttggcgccgttggctgaggcggtgcgtttgggggatgcgactgcggtgctggggatgttg
cgtcgcggcacacttcgtggggtgcaatttcatgagggggtcttggatccgtgtgtcggg
gctggtcaggtgttgttggcgcattggcgtgcgttggctgcgttgtctgatccggtgcag
gcattggcagcggcggggcgattacgtttgttgacggcgttgcgtgaggggccgcagggg
gcggcggggatcaatgcgcggattgagcgcctgctcggcggcggcggtgtggatggttac
tttcatgggcggctgttgttgatgactgagactagttctcgtcagcgtttgttcaatggt
gatattggggtgtgtcttcgggatgatgatgggacgatgtgggcttggttttctggtgct
gggggagagggtgtccgcgcatttgcaccggctgcgttgccggcgcatgagagtgcgttt
gcgatgacggtgcataaggcgcaggggtcggagttcgatacggtgtggttgcagttgccg
cgtcaggagagtcgggtgctgtcacgggagttgatctatacggggttgactcgtgcacgc
catgggttgcatgtggcgggcagtgagtcggtgttgtgtgcggcgttggcacggcaagcg
gtgcgtgtgtcggggctggcttggcggcttggtgtcactggttgcaacacggtgccaata
ggggcaggtgcgggggatgcggaggtgtttggcaagggggggcaaggggtgttgttctga

DBGET integrated database retrieval system