KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_02780Help
Entry
XFLM_02780        CDS       T01979                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XFLM_02780
Enzymes [BR:xff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XFLM_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
583064..584017
Genome map
AA seq 317 aa AA seqDB search
MHSVVVVGSFSIDHVWRCDTLPTPGATIAGRYSRGPGGKGFNQAVAACRAGARTYFICAL
GNDTDGNMARDIATKDGFTLIGESSTEPTGTGGIYVDSHGHNTIVTGAGANAVLSTHFIT
EQRALITSAWIVLAQLESPIETLETALSMAREAGRLTILNAAPANATATINLLKLADVLT
LNETEFVALLSRHVGERISPDNVATTDGNTLHALCNKLLSGSTVVITLGSAGVFVSHSEE
NLRGDTQPYYRVAAEQAHTVDTTGAGDAFNGALAASLARQPNTAFIQHIRLANSYAARST
ETEGGAVSMPILTTTQD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagtcgtcgtcgtcggctccttcagtattgatcatgtttggcgctgcgacaca
ttgcccacacctggtgcaacaattgccggccgctatagccgtggtccaggaggcaaaggc
ttcaaccaagccgtggcggcttgccgcgctggtgcgcgcacctatttcatatgcgcactc
ggcaatgacaccgacggcaatatggcacgcgacatcgccacaaaagacggcttcacactg
atcggcgaatccagcaccgaacccactggcaccggagggatctatgtcgacagccacggc
cataacactatcgtcactggcgctggtgccaacgcagtactgagcacccacttcatcaca
gaacaacgcgccctaattacctcagcatggatcgtcttggcacaactggaatcaccgata
gaaacactcgaaacggcgctcagcatggcgcgcgaagctggccgcttgaccatactcaat
gctgcccccgccaatgcaaccgccacgatcaacctactcaaattggccgacgtgctcaca
ctgaacgaaacggaattcgtcgccttgctcagccgtcacgtcggtgaaaggatcagtccc
gacaacgtcgccaccaccgatggcaacacactacacgccttatgcaacaaactactgtcc
ggcagtacggttgtcattacattaggctcggctggcgtattcgtttcacactcggaagaa
aacctgcgtggtgacacccagccctactatcgtgtggccgccgaacaggcccacaccgta
gacaccaccggagctggcgacgcatttaatggtgctttggcagcatccctggcacggcaa
ccaaacacagcgtttatccagcacatacgcctcgccaatagctatgcagcgcgctcgacc
gaaacagaaggtggagccgtatcaatgccaatattaacgactacccaagactaa

DBGET integrated database retrieval system