KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_03465Help
Entry
XFLM_03465        CDS       T01979                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XFLM_03465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFLM_03465
   00020 Citrate cycle (TCA cycle)
    XFLM_03465
   00620 Pyruvate metabolism
    XFLM_03465
Enzymes [BR:xff01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XFLM_03465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711286..712941
Genome map
AA seq 551 aa AA seqDB search
MTEIKEAFVPDIGDYSNVPVIEVLVAVGDTVSKGQSLITLESDKATMEVPSSTAGIIKEI
KVKVGDTLSQGHVVALIEVSEETAEVTTPMTVNTPTTRAHNTAHPEDEGSLIEVRVPDIG
DYTNVPVIEVLVAVGDTVSKDQSLITLESDKATLEVPSSATGVIKQLKVNIGDTLSQGDI
VVVLQSAESTPLTPTTNKPALPPNSSPAGDAISAPASPAGTQSTPPITFDANTVLPSKVP
YASPAVRLLARQLDVDLSRIKGSEKNGRITREDVQKFVNTTLGTGMAEGRTPSASITTNG
GLNLLPWPNVDFSKFGEIETQPLSRIKKISGANLARNWAMIPHVTQFDQADITQLEALRV
QINKENAASNKNGTGIKLTVLAFLIKASASALKKFPTFNASLDATGETLTLKKYFHIGFA
ADTPNGLVVPVIRNVDQKGIVEIAQETSDLAKKARDGKLTPADMSGGCFSISSLGGIGGT
AFTPIINAPEVAILGVSKSLIQPIWDGTQFAPKMLLPLSLSYDHRVIDGALAAHFTTYLS
QILADMRRVLL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcaaggaagcttttgtccccgatatcggtgactacagcaacgtcccagtg
attgaagtgctagtcgctgttggcgataccgtctccaagggccaaagtttgatcaccttg
gaatctgacaaagcaaccatggaagtaccttcgtcaacagccggtatcatcaaagaaata
aaagtgaaggttggcgataccttatcccaaggccatgtcgtcgcattaatcgaagtctcc
gaagagactgccgaagtcaccacacccatgaccgttaacacgccaaccacgcgtgctcac
aacactgcacatccagaagacgaaggcagcttaatcgaagtgcgtgtccctgatattggc
gattacaccaacgtcccagtgattgaagtcctggtcgctgttggcgataccgtctccaag
gaccaaagtctaatcaccttagaatctgacaaagcaaccttggaagtgccctcctccgcc
accggtgtcatcaaacaactcaaggtcaacattggagacaccttgtcgcaaggcgatatc
gtcgttgtgcttcaaagcgcagagagcaccccactcactccaaccacaaacaaaccagca
ttgccacccaattccagccctgcaggggatgccatctccgccccagcatcccctgcaggg
acacagagcaccccaccgatcaccttcgacgccaacaccgtgctaccgtccaaggtcccc
tatgccagccccgccgtacgcctgcttgcacgccagttagacgtggacctgagccgcatc
aaaggcagcgagaaaaatggacgcattacccgcgaagacgtacagaaattcgtcaacacc
accttaggtactggtatggctgaaggcagaacaccctccgcttcaatcaccacaaatggt
ggcctcaacttactcccttggccgaatgtggatttcagcaaattcggcgaaattgaaacc
cagcctttatctcggatcaaaaagatttccggtgccaatcttgcccgcaattgggcgatg
atcccgcacgtcacccaatttgatcaggccgacatcacccaactggaagccctgcgcgta
caaatcaataaagagaatgccgcatccaacaagaacggaaccggcattaaactgactgtt
ctggctttccttatcaaagcaagcgcctcagcactgaaaaaatttccaacattcaacgcc
tcccttgatgccactggcgaaacgctcacactcaaaaaatacttccatatcggtttcgcc
gccgacacaccaaacggactcgtcgtcccggtgatccgcaacgtagaccaaaaaggcatc
gtagagatcgcacaagaaaccagcgatctcgccaaaaaagcacgcgatggcaaactcacc
ccagcagacatgagcggtggttgcttctccatcagctcactcggtggcatcggaggtacc
gcattcacacccattatcaacgcacctgaagtagcgatcctgggtgtctccaaatccctc
atccaacccatctgggatggcacacaattcgcacctaaaatgctgttgccgctgtcacta
agctacgatcaccgcgtcattgatggtgccttggccgcacacttcaccacttatctcagc
cagatactcgccgacatgcggcgcgtactgctgtga

DBGET integrated database retrieval system