KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_03525Help
Entry
XFLM_03525        CDS       T01979                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
722703..723380
Genome map
AA seq 225 aa AA seqDB search
MTAPPSLQAKAVGIGMTSQRVRDRLVERLRECGIQDERVLSTIRIVPRHLFIDEALALRA
YEDTALPIGHGQTISQPWVVARMTEAVMQVVPKKILEIGTGSGYQSAILASLGLEVYTIE
RIGKLLRQARKRFRQLGIKIRSKHDDGSTGWTEHAPYNAILVTAAAPTLIDTLIEQLAIG
GRLVAPVGTASEQALVQLTRTIDGSITHEILEPVTFVSLLPGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacctccatccctgcaagcgaaagccgtagggatcggcatgacgtcgcaacgc
gtccgagaccgcctggtcgaacgactacgcgaatgcggcatccaagacgaacgggtactc
agcaccattcgcatcgtgccacgccatttattcattgatgaagccttggcactgcgcgct
tacgaagacaccgcattgcccatcggccatggacagaccatctcgcaaccctgggtcgtc
gcacggatgaccgaagctgtcatgcaggttgtccccaaaaaaatactcgagatcggtaca
ggttccggctaccagagcgccattctggcctcactaggattggaggtgtacaccattgag
cgtatcggcaaactactgcgtcaagcacgtaagcgtttccgccagcttggcataaaaata
cgcagcaaacacgatgacgggagcaccggctggacagaacatgcaccttacaacgccatc
ttggtcacagcagcagccccgacactgatcgacactctcatcgaacaacttgcaataggc
ggacgcctggtggctcctgtcggcaccgcttcagagcaagccctagtgcagctcacacga
acaatcgacggtagcatcacacacgagattttagaaccagtcacatttgtatccctgcta
ccagggatgttggattaa

DBGET integrated database retrieval system