KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_03575Help
Entry
XFLM_03575        CDS       T01979                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xff00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xff00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
732520..734958
Genome map
AA seq 812 aa AA seqDB search
MPPTPVHPTQALPLLRALLTLCIAALSTTSFDTTASHHKKSQHPLPPRTASGPPLPPLPL
IPAPVQIQRGHGQIHIGPHTLISIPPNDTDAQHSATYLATLLQHTRNLTLHIHTETTPTP
DSIRLQRDPQSPVTQTEGYTLQALPNQGMHITARDGAGLFYGAITAWQLLTADSNQGPTE
IPTVTIHDWPRFKWRGQLLDVARHFHDVDTVKHVIDAMAQHKLNVLHLHLTDDQGWRIEI
KRYPKLTAIGAERIPPGAGRHGTPERYGGFYTQDQIRELVAYATERQITILPEIDMPGHA
QAAVAAYPDIIGVTGTTPPVSVDWGINPYLFDTSTPSLDFIRNVLDEVLTLFPSQYIHIG
GDEAVKDQWEASHTIHAQMRKLGVKDTHAMQGWFNTQLSQYLTTHDRRLIGWDEIIQSGL
PDNAAVMSWRGVEGAITAAQQGHDVVLAPAGWMYLDNLQTERNDEPNGRLATLPLSRVYA
LDPVPKELTPDQAIHILGLQSALWSEYIPSRWHIDHALFPRLAAVAEVAWSPMTARNWDN
FLKRLPPQLHRYRTLHIDYSDGPFAPDIMLQHRSAYVLAGAPPHITLSNQTNTGQIHYTT
NGNEPTLHSPRYTAPFPITLPTTVKATVFTEDGRPLATTRSRTFDHNTLLSVDTQELRNC
SDKGPLGLRVPLLPDMPDPNTPVYNVDLFHACWIVPQIRLNNIQVIHIDAARLARNYGLA
HDQSKVIQYPKHTAHGELEIRTDCNKKPLAVIPLPPGDTIGEPFTLDAPLPPTIGVHDLC
LRITAPIHGPLYAIGRVQLIHNTPASPPPPTH
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgccccccacccccgtccacccaacacaggcactcccattactgcgggcattgctcacc
ctgtgcattgccgcactgtcaacaacgagcttcgacaccaccgcatcacaccataaaaaa
tcacaacacccattacccccgagaactgcttccggcccaccactaccaccactaccactg
atccctgcacccgttcaaatacaacgcggtcacggccaaatccacattggcccccacacc
ctgatctccatcccccccaacgataccgacgcacaacacagcgccacctacctagccaca
ctgctacagcacacccgcaacctgacattacacatccacaccgaaaccacccccacacca
gacagcatccgcctacaacgcgacccacaatcacccgtcactcagacagaaggctacacc
ctgcaagccctccccaaccaaggcatgcatatcacggcacgagacggagcaggactgttc
tacggcgcgatcactgcatggcaactactgaccgccgacagcaaccaaggcccaaccgaa
atccctaccgtcaccattcacgactggccacgcttcaaatggcgcggccaactccttgac
gtcgcccgtcacttccacgacgtagacaccgtcaaacacgtgattgacgccatggcacaa
cacaaactcaacgtcctgcacctacacctcaccgacgaccaaggctggcgtatcgaaatc
aaacgctaccccaaactcactgcaatcggcgccgaacgcatcccaccgggcgccggacgc
cacggcaccccagaacgctacggcggcttctacacccaagatcaaatccgcgaactcgtg
gcctacgccaccgaacgacagatcaccatactccccgaaatcgacatgcccggccatgca
caagccgccgtggcagcctaccccgacatcatcggagtcaccggcaccaccccacccgtc
agcgtcgactggggcatcaacccctacctcttcgacaccagcacacccagcctggacttc
atccgcaatgtactcgacgaagtactcaccctattcccctcccaatacatccacatcggc
ggcgacgaagccgttaaagatcaatgggaagcctcacacaccatccacgcccaaatgcgc
aaactgggcgtgaaagacacacatgccatgcaaggctggttcaacacacaactttcccaa
tacctgacaacacatgaccgacgcctgatcggttgggatgaaatcatccaaagcggcctg
ccagacaacgccgcagtgatgtcctggcgcggcgtcgaaggcgccattactgccgcacaa
caaggacacgacgtcgtcctcgcccccgctggctggatgtacctagacaacctgcaaacc
gaacgcaacgacgaaccaaacggccgcctcgccaccctgcccctctcccgcgtctacgca
ctggaccccgtccccaaagaactgacccccgaccaagccatccacatcctgggcctacaa
agcgccctgtggagcgaatacatcccctcacgctggcacatcgaccacgccctattccca
cgcctcgccgccgtcgccgaagtcgcctggtcccccatgaccgcacgcaactgggacaac
ttcctcaaacgcctccccccacaactacaccgctaccgcaccctgcacatcgactacagc
gacggcccattcgcccccgacatcatgctgcaacaccgctcagcctacgtccttgctggc
gccccccctcacatcacactcagcaaccaaaccaacaccggccaaattcactacaccaca
aacggcaacgaaccgaccctacattccccccgctacaccgccccatttcccatcaccctc
cccaccaccgtcaaagcaaccgtattcaccgaagacggccgccccctggccaccacccgc
agccgcaccttcgaccacaacacactgctgagcgtggacacccaagaattacgcaactgc
tccgacaaaggaccactgggattacgcgtccccctcctaccagacatgcccgaccccaac
acccccgtgtacaacgtcgacctattccacgcctgctggatcgtcccccaaatacgcctc
aacaacatacaagtcatccacatcgacgccgcacgcctagcacgcaactacggcctggcc
cacgaccaatccaaagtcattcaatatcccaaacacaccgcacacggcgaactggaaatc
cgcaccgactgcaacaaaaaaccactggccgtgatccccctcccgcccggagacaccatc
ggcgaaccattcaccctcgacgccccattaccaccgaccatcggcgtccacgacctgtgc
ctacgcatcaccgcccccatccacggcccactgtatgccattggtcgcgtccaactgatc
cacaacacccccgcatcacctccgccacccacacactga

DBGET integrated database retrieval system