KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_03715Help
Entry
XFLM_03715        CDS       T01979                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XFLM_03715
Enzymes [BR:xff01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XFLM_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
771223..773067
Genome map
AA seq 614 aa AA seqDB search
MSFSKHFGKLMLATCLSLSAAPAFSYSISHGKVVDDKGNQIQLRGVNWFGFETGDHVVNG
LWARNWKEFITQLQGMGFNAIRLPFCPANLNSNTSPSSIDYSRNPDLQGLSSLQILDKVV
KELSDRRMYVLLDHHRPDCSAISELWYTDSYSEKQWIDDLRFVAHRYANVHGVIGLEVKN
EPHGRTTWGTGDPKTDWNTAVEHAAAAILEAAPKWLIGVEGIGENPICSSTIGHFWGENL
EPMDCTPLKVPADHLLLMPHVYGPDVYVQPYFNSPDFPNNMAAIWDKHFGHFAKAGYAMA
IGEFGGKYGEGDPRDIAWQNAFVDYLISIGVTDAFYWAANQNSVDTGGMVGNDWTTPRDD
KVKLLNKLWNAGGGASGGSGGGAGASSGSGAGGGSSGGAGTGSGSGAGGGSSGGAGTGSG
SGAGGGSSGGAGASSGSGAGGGSSGGAGTGSGSGAGGGSSGGAGASSGSGAGGGSSGGAG
ASSGSGAGGGSSGGAGAGSGSGARGGSSGGAGAGSGSGAGGGSGSGSDPTKSKIAVNTIV
DSDWHTGYCERIQVTNTSDSPNTWTVTIPIKGKIQTLWSARWSVKDNALTAFGMDWNKTL
DPKGRTEFGFCSNY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttccaaacacttcggcaaactcatgttggccacgtgcctatccttatctgcg
gcaccagcattcagttacagcatcagtcacgggaaggtcgtcgatgacaaaggcaaccaa
atccaattaaggggcgtcaactggtttggttttgaaaccggagatcatgtggtaaatgga
ctatgggcacgtaattggaaagaattcatcacacagctacagggcatgggattcaacgcg
atacgtttaccgttctgcccagccaatctaaatagcaacacatcaccaagcagcattgat
tacagccgcaatccggacttgcaaggcttgagctcgctgcaaatcctggacaaggtcgtc
aaagaattgagcgaccgcagaatgtatgtgctgctagatcaccatcggccggactgctca
gcaatctctgagttgtggtacacggattcatacagcgaaaaacagtggattgatgatcta
cgcttcgtcgcacaccgttacgccaacgtacacggcgtcatcggcttggaggtaaagaat
gaaccacatggcagaaccacctggggcaccggagatccaaaaactgattggaacaccgca
gtcgagcatgcggcagcagcgatcttggaggccgcaccaaaatggctgatcggagtcgag
gggattggagagaatcccatctgctccagcaccattgggcatttttggggcgaaaacctg
gaaccgatggactgtacgccactgaaagtccctgccgaccatttgctattgatgccacac
gtctacgggccagatgtctacgtacagccgtacttcaatagtccggatttcccaaacaac
atggcagcgatctgggataaacacttcggacattttgcgaaagccggctacgcgatggcg
attggtgagttcggtggcaagtacggtgaaggtgatccacgcgatatcgcttggcaaaac
gctttcgtggattacctcatcagtatcggcgtgacggatgccttctattgggcagcaaac
cagaacagcgtcgataccggcggcatggttggcaatgactggaccaccccacgcgatgac
aaggtgaagctgctgaataagctgtggaatgccggtggtggtgccagtggtggttccggc
ggcggtgctggtgctagttccggcagtggtgctggcggcggctccagcggcggtgctggt
actggttccggcagtggtgctggcggcggctccagcggcggtgctggtactggttccggc
agtggtgctggcggcggctccagcggcggtgctggtgctagttccggcagtggtgctggt
ggcggctccagcggcggtgctggtactggttccggcagtggtgctggcggcggctccagc
ggcggtgctggtgctagttccggcagtggtgctggcggcggctccagcggcggtgctggt
gctagttccggcagtggtgctggcggcggctccagcggcggtgctggtgctggttccggc
agtggtgctcgcggcggctccagcggcggtgctggtgctggttccggcagtggtgctggc
ggcggctccggtagcggctccgatcctacaaagagcaagattgctgttaataccatcgta
gacagcgattggcatactggttactgcgagcggatccaagtgacgaataccagcgacagt
ccgaatacctggacggtgacgattccaatcaaggggaagatccagacgctatggagcgcg
cgttggtcagtgaaggataacgcactcaccgcttttggtatggactggaataagacgctt
gatccgaaaggcaggactgaattcgggttctgttcgaactattga

DBGET integrated database retrieval system