KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_04315Help
Entry
XFLM_04315        CDS       T01979                                 

Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907998..908654
Genome map
AA seq 218 aa AA seqDB search
MTIDFSIAREKMVEQQIRPWDVVDLHVLDVLAHIPREAFVPEPYRTLAYADLEIPLPGGQ
TMMKPVIEGRLLQALMLSPEEDVLEIGTGSGFLTACLASLGHEVVSLEINSALAASARTH
LDTIGLGSNVHIEQADAFTWQPERQFSVICLTGAVSTLPLQFLQWLHPNGRMFAIHGHSP
AMQAVLVRGDASTPNITSLFETDLAYLKGGEPALQFHF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgatttttccatagcccgcgaaaaaatggtcgaacagcagatccgtccatgg
gatgtggtggatctgcacgtacttgatgtactggcacacatcccacgcgaggcgttcgtc
cctgaaccataccgtaccctagcctacgcagaccttgaaatccccttacccggcggacaa
acaatgatgaaacccgtcattgaggggcgcctacttcaagccctgatgttgtcaccagaa
gaggacgtattggaaatcggcaccggcagtggtttcctcactgcctgcttggcttcactg
ggacacgaagtagtcagcctagagatcaattccgcactggccgcatcggcacgtacccac
ctagataccattggcctaggcagtaacgtacacattgagcaggccgacgctttcacttgg
caacccgaacgtcagttcagcgtcatttgcttgactggtgcagtgagcacgctgccactg
caatttctgcaatggctacaccccaacggccgtatgttcgctatacacggccactcccca
gcgatgcaagctgttctggtgcgtggagatgcctctaccccaaacatcacatccctgttt
gagaccgatctggcttacctcaaaggtggcgagccagccctccaatttcatttttga

DBGET integrated database retrieval system