KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_04820Help
Entry
XFLM_04820        CDS       T01979                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XFLM_04820
Enzymes [BR:xff01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XFLM_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032875..1033879
Genome map
AA seq 334 aa AA seqDB search
MTTLAPTSPSHTTNILTYAGINLPGPEFSPSNKPGVLYKDYLYPSASDYAYVAKKGMNIV
RLPVLWERVQPTLNDALDATQLNLILNAVEQAKAQKLHIILDIHNYAKYNDELIGSDNVP
ISAFADLWKRLSLQFSNDKAVIFGLMNEPHEITSTTWAKAAQAAINAIRSTGARNLVLVP
GTAYSGAHSWLSSYYGIPNGEALLNINDPAKHMAFEVHQYLNENSTGTTGECISTTIGAE
KLEAFTNWLRTYHKTGFLGEFATGNNDTCNQALEGMLSYIEENADVWLGLTWWGSNPWFS
PNYPFNLHPNSDGNDKPQMSILESHTRKITKIHK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacactggcaccaacatcaccaagccataccacaaacatactgacgtacgctggt
atcaatcttcctggcccggaattcagcccaagcaataaaccaggtgttctctataaggac
tatctttatccaagtgcatctgactacgcttacgtggccaaaaagggcatgaacatcgtg
cgcctccctgtcctttgggaacgcgttcagcccacactgaatgatgcattggacgccacg
caactcaacctgattcttaacgccgtcgagcaagcgaaagcacagaaattacatatcatt
ctagatatccataactacgccaaatataacgatgagctgatcggcagtgacaatgttcct
atcagcgccttcgccgatctatggaagcgtctgtccctacagttttccaacgacaaagca
gtcatcttcgggctgatgaacgagcctcatgaaatcacctcaaccacttgggctaaggct
gctcaagcagccatcaacgcaatccgcagcactggcgcacgtaaccttgtattagtgccg
ggtaccgcttacagcggcgcacacagttggctgagcagctactacggcatccctaatgga
gaagcgctgctgaacatcaatgatcctgccaaacacatggcgttcgaagtacaccaatat
ctcaatgaaaatagcaccggcacgacgggcgaatgcatcagcaccaccatcggagccgag
aagctagaagcattcaccaactggctgcgcacctaccataaaaccggtttccttggcgag
ttcgctactggcaacaacgatacttgcaaccaagcattggaaggcatgctcagctatatt
gaggaaaacgcagacgtctggttgggactgacgtggtggggatctaacccctggtttagt
cccaattatccattcaacctgcatccaaacagtgacggcaacgacaagccgcagatgagc
atcctggaatcacacacacgtaagatcactaaaatccacaaataa

DBGET integrated database retrieval system