KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_05505Help
Entry
XFLM_05505        CDS       T01979                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:xff03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1191284..1192099
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWDIPSHIESRLPGHRITTVCRRAKYL
LIDTNAGGSLIIHLGMSGTLRLLAPETPLRPHDHVDIMLNNRRVLRFNDPRRFGCLLWQE
DGQIHPLLQRLGCEPLSDSFNGDYLYQCSRARNVSVKTFLMDQRIVVGVGNIYAAESLFR
AGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDFLSPDGRPGYFKQELFVYG
RQQQPCKQCGSLLRQTTIRQRTTVWCGHCQG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactcccagaagtcgaaaccacattgcgtggactgttgccctatttgaccaat
caactgatctattctcttaccctgcgtaggcgtaccttgcgctgggatatcccttcccat
atcgaaagtcgtctcccaggccatcgcatcactactgtgtgtcgtcgggccaaatacttg
ctgatcgatactaatgcagggggaagtctcatcatccaccttggcatgtccggtactctg
cgcttactggcgccagaaacgcctctacgcccacacgatcatgtggacattatgttgaat
aaccgtcgtgtgctacggttcaatgaccctcgccgcttcggatgcttgctctggcaagaa
gatggacaaatccaccctctcctacagcgcctcggctgcgaaccactctcagatagtttt
aatggtgattatctttatcagtgcagccgtgctcgcaatgtgtccgtgaaaacgtttctc
atggaccaacgcattgtggtcggtgtcggtaatatctatgctgctgaaagtttgttccgt
gccggtatcagccctctatgcgaggctgacaaaatatccctccaacgctatcggcgcttg
gctgaagtggtcaaggatatcctcctatatgccatcaaccgtggaggaactaccttgcgg
gatttcctcagtcccgatggacgccccggctacttcaagcaggaattgtttgtctacggt
cgtcagcaacagccttgtaagcagtgtggaagcctcctgcgtcaaaccactatcagacag
cgaactactgtctggtgcggccactgccaaggttga

DBGET integrated database retrieval system