KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_05790Help
Entry
XFLM_05790        CDS       T01979                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xff00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xff00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:xff03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:xff03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xff03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1253967..1254392)
Genome map
AA seq 141 aa AA seqDB search
MARADFYLIAKPRFLEKPLQLVCELVRKAYDTHQPTLILARDQAQAEALDDLLWAFDPDA
YIPHQIAGSDEDDDITPVLIATPDSDTPSRPLVINLRDAPWDGPCERVLEVVPADPAARE
PLRERWKHYKARGLHMNKHDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgccgacttctatttgattgccaaaccgcgctttcttgagaaaccgctgcaa
ttagtctgcgaattagtccgcaaagcctacgacacccatcagcccacactgattctggcc
cgcgaccaggcccaggccgaagcactggatgacctactgtgggcgttcgacccggacgcc
tacatcccccaccaaatcgctggcagcgacgaagacgacgacatcacccccgtattgatt
gccaccccggacagcgacaccccatcgcgcccgctggtcatcaacctacgcgacgcccct
tgggatggcccctgcgaacgcgtgttggaggtggttcccgctgatcctgcggcacgcgag
ccactgcgtgaacgctggaaacactacaaggcacgcggcctgcacatgaacaaacacgac
atgtga

DBGET integrated database retrieval system