KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_06215Help
Entry
XFLM_06215        CDS       T01979                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xff00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1356186..1356683
Genome map
AA seq 165 aa AA seqDB search
MTSGNVVAYVGLGANLGPAEMTLRAAIAALDQLPFTRLRIASSLYRTPPWGRQDQAEFVN
AVAALETRLAPLALLDALLEVECLHGRVRLPGDRWGPRTLDLDLLLYGEHVLDLPRLRVP
HPHLHERTFVVVPLAEIAAELVLPRHGMVCELLEHMDTLGLVPIR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtggcaatgtggtggcttatgttgggttgggcgccaatctcggcccggctgag
atgacgttgcgagccgcaattgctgcgttggatcagttgccgttcacccgtctacgcatt
gcttccagtttgtatcgcacccctccctggggacgtcaggatcaggcggagtttgttaat
gcggttgcagcgttggaaacaaggttagcgcctttagccttgttggatgcattgttggag
gtggaatgtctccatgggagagtgcgtcttcccggcgaccgttgggggccgcgtacactt
gatctggatttgttgctttatggggagcatgttttggatctgccgcgactgagggtgcct
catcctcatctacatgagcgcacttttgtagtggtgcctttggccgaaattgctgcggag
ttggtgcttcctcgtcatgggatggtatgtgagctattggagcatatggataccttgggc
ttggtaccaatcaggtag

DBGET integrated database retrieval system