KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_06580Help
Entry
XFLM_06580        CDS       T01979                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XFLM_06580 (tpiA)
   01230 Biosynthesis of amino acids
    XFLM_06580 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFLM_06580 (tpiA)
   00051 Fructose and mannose metabolism
    XFLM_06580 (tpiA)
   00562 Inositol phosphate metabolism
    XFLM_06580 (tpiA)
Enzymes [BR:xff01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XFLM_06580 (tpiA)
Exosome [BR:xff04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XFLM_06580 (tpiA)
  Exosomal proteins of bladder cancer cells
   XFLM_06580 (tpiA)
  Exosomal proteins of melanoma cells
   XFLM_06580 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1436229..1436978
Genome map
AA seq 249 aa AA seqDB search
MRPKIVAGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLYLSDLAQRFKGEGLAF
GAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHEDSELVARKFAAALSAGL
RPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLIAYEPVWAIGTGRHADPS
QVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFSQQDVDGGLIGGASLVADD
FLAIARATV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccaagattgtggctgggaattggaagttgcatggtagccacgcgttcgcacag
gcattggttgcgcaggtcgctgctggtttgccgctgcctggagtcagtgtgattatcttg
ccgccattgctgtatctgagtgatttggcgcagcgcttcaaaggggaaggtttggcgttt
ggtgcgcagaacgtcagtcaccatgataaaggtgcttacactggggaagtttcggcggcg
atggtggctgatgtcggtgctcattacactttggttgggcattctgaacgtcgggagtat
caccatgaggacagtgagttggtggcgcgtaaatttgctgctgctctgagtgctgggttg
cgaccaattctatgtgttggggagagtttgccccagcgtgaggctggacaggcagaggtt
gccattgcgatgcagcttgcgcctgtgttggctctggttggcccgcagggtgttgcccgt
ggcttgattgcctatgagccggtttgggcgattggtactggccgtcatgcggatccgagc
caagttcaagcgatgcacgcttttattcgtggtgaaattgcgaggcaagatgctagaatc
ggcgattctctgttgattctatacggaggcggcatcaagccttgcaatgctgctgagttg
ttttcccagcaggatgtcgatggtgggttgattggtggtgcttcgttggttgctgatgat
ttcttggctatcgctcgtgcgacggtttag

DBGET integrated database retrieval system