KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_06580Help
Entry
XFLM_06580        CDS       T01979                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00010  Glycolysis / Gluconeogenesis
xff00051  Fructose and mannose metabolism
xff00562  Inositol phosphate metabolism
xff01100  Metabolic pathways
xff01110  Biosynthesis of secondary metabolites
xff01120  Microbial metabolism in diverse environments
xff01130  Biosynthesis of antibiotics
xff01200  Carbon metabolism
xff01230  Biosynthesis of amino acids
Module
xff_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFLM_06580 (tpiA)
   00051 Fructose and mannose metabolism
    XFLM_06580 (tpiA)
   00562 Inositol phosphate metabolism
    XFLM_06580 (tpiA)
Enzymes [BR:xff01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XFLM_06580 (tpiA)
Exosome [BR:xff04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XFLM_06580 (tpiA)
  Exosomal proteins of bladder cancer cells
   XFLM_06580 (tpiA)
  Exosomal proteins of melanoma cells
   XFLM_06580 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADN63240
Position
1436229..1436978
Genome map
AA seq 249 aa AA seqDB search
MRPKIVAGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLYLSDLAQRFKGEGLAF
GAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHEDSELVARKFAAALSAGL
RPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLIAYEPVWAIGTGRHADPS
QVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFSQQDVDGGLIGGASLVADD
FLAIARATV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccaagattgtggctgggaattggaagttgcatggtagccacgcgttcgcacag
gcattggttgcgcaggtcgctgctggtttgccgctgcctggagtcagtgtgattatcttg
ccgccattgctgtatctgagtgatttggcgcagcgcttcaaaggggaaggtttggcgttt
ggtgcgcagaacgtcagtcaccatgataaaggtgcttacactggggaagtttcggcggcg
atggtggctgatgtcggtgctcattacactttggttgggcattctgaacgtcgggagtat
caccatgaggacagtgagttggtggcgcgtaaatttgctgctgctctgagtgctgggttg
cgaccaattctatgtgttggggagagtttgccccagcgtgaggctggacaggcagaggtt
gccattgcgatgcagcttgcgcctgtgttggctctggttggcccgcagggtgttgcccgt
ggcttgattgcctatgagccggtttgggcgattggtactggccgtcatgcggatccgagc
caagttcaagcgatgcacgcttttattcgtggtgaaattgcgaggcaagatgctagaatc
ggcgattctctgttgattctatacggaggcggcatcaagccttgcaatgctgctgagttg
ttttcccagcaggatgtcgatggtgggttgattggtggtgcttcgttggttgctgatgat
ttcttggctatcgctcgtgcgacggtttag

DBGET integrated database retrieval system