KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_06855Help
Entry
XFLM_06855        CDS       T01979                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xff01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xff00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494264..1495292
Genome map
AA seq 342 aa AA seqDB search
MDLAHFVSANITAGRQLVIVSSGAVAAGRALIPPLPESGGALAARQALAALGQAQLIALW
QRFFDRPVAQVLLTHDDLRNRRRYLNARATLRELLHLGTLPVVNENDTVSVDELKLGDND
NLAAIVAALIDAQALFIATDIDGLYTTDPRHHSDAQPLHEVRTLTPENLAMAGDSSSTVG
TGGMRTKLEAALKAGAAGIDTYLFNGRSSDVVRGLAQHRLRGTRIHPTCTPIAARKYWLR
HAPVEPGAILIDAGAAAALAQQGASLLPGGVLSAEGDFRRGDMIQIATRSPDHPSHPLAR
GLVQYSAADVRRIAGCHSRDIQTLLGYTYGDTIVHRDDLVLL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttggacttagcacacttcgtctccgccaacatcaccgccggacgccaactcgtcatcgtc
tcctctggcgctgtcgccgctggtcgtgccctgatacccccactgcccgaatccggcggc
gctctcgccgcccgccaagccttagctgcccttggacaagcacaactcatcgcactgtgg
caacgcttcttcgaccgccccgttgcccaggtcctcctgacccacgacgacctccgcaac
cgccgtcgctacctcaacgcacgtgccacattgcgtgaactactgcacctgggcaccttg
cctgtcgtcaacgaaaacgacaccgtctccgtcgatgaactcaaactaggcgacaacgac
aacctggcagccattgttgccgcactgattgatgcccaagccctgtttatcgccaccgat
attgacggcttatacaccaccgacccacgccaccattctgacgcacagcccctgcatgaa
gtccgcaccctgacccctgaaaaccttgccatggctggtgacagcagcagcaccgttggc
accggcggtatgcgtaccaaacttgaagcagcacttaaagccggcgccgctggcattgac
acctacctatttaacggccgcagcagcgacgttgtccgcggactcgcacaacaccgcctc
cgcggcacccgcatccatcccacctgtaccccgattgccgcccgtaaatattggttgcgt
cacgccccagtggagcccggcgcgatcctcatcgatgccggtgccgccgctgccttggca
caacaaggcgcttccctacttccgggcggcgttttgagtgccgaaggcgacttccgccgc
ggcgatatgatccagatagccacccgcagcccagatcacccctcccaccccctggcacgc
ggacttgtccaatactcagccgccgatgtccgccgcattgccggttgccattcccgcgat
attcaaaccctccttggatacacctatggcgacacaatcgttcaccgtgatgacctcgtc
ctcctctga

DBGET integrated database retrieval system