KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_07130Help
Entry
XFLM_07130        CDS       T01979                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XFLM_07130
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XFLM_07130
   00650 Butanoate metabolism
    XFLM_07130
  Energy metabolism
   00190 Oxidative phosphorylation
    XFLM_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1561035..1561418
Genome map
AA seq 127 aa AA seqDB search
MSRYRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAV
AKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALTLQTMVRFIAVLGAVASVFAV
VRIALGN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttaccgtacaccactcaaaaatgcccgtggtctaggtgctgctaaggtgggg
accgggcattttgtgttgcagcgcctcactgcgattgcattagtattgctgggagtatgg
tttttggcatttttgctgactttgcttggtgtcgactatgcagcagcggttgcagccgtc
gccaaaccttggaatgcaatattgctcattggattcctggtcgctgccttttggcatgcg
cagctcggtttgcaggtggtacttgaggattacatccacaactcttttctggctttgaca
ctccagacgatggtgagatttatcgctgtccttggcgcggtcgccagcgtttttgcggtc
gttcgtatcgcgcttgggaactga

DBGET integrated database retrieval system