KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08030Help
Entry
XFLM_08030        CDS       T01979                                 

Definition
(GenBank) arginase/agmatinase/formiminoglutamase family protein
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XFLM_08030
  Amino acid metabolism
   00220 Arginine biosynthesis
    XFLM_08030
   00330 Arginine and proline metabolism
    XFLM_08030
Enzymes [BR:xff01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XFLM_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1749111..1749962
Genome map
AA seq 283 aa AA seqDB search
MLFPQWQGGNQELYGLGARLLAWLAPETEAPMFEVNVPEFKKETPEPERGVIYRQQLFKQ
YDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLWIDAHPDIKTPQDSIN
GHTMVLGSLLGEGDNEFAAKVKVPLKPSRVMFAGLIETGLTEQETEVIHRLGLNVAKPEV
LFDNSQTVIDWVRKEKIEKLVIHFDLDVLHPDVFRSLLFAEPEPEFDWRATYPVGQLRLA
QVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttcctcaatggcaaggtggaaatcaggagctatatggtttgggcgcacgtctt
ctggcttggttggcgccggaaacagaggcgcctatgtttgaggtgaatgtgcctgagttt
aaaaaagaaacgcccgaaccggagagaggggttatctacaggcagcaattattcaagcag
tatgatgaagcttatcgactgttggagcgggaagatccggattatgtggtgatctttggt
ggtgattgcctggtggatttggcgccttttgcttggttgaatgagaaacatcatggtcag
ttgggtgtgttatggattgatgctcatcctgatataaaaacaccacaggattctataaat
ggtcacacgatggttctgggaagtttgctgggtgaaggtgataacgaatttgccgcaaag
gtgaaagttccgctgaagccgtccagggtgatgtttgcagggttgattgaaacggggttg
acggagcaggagactgaggtaattcatcgccttggactcaatgtggccaaaccggaggtg
ttatttgacaacagccagacggtgattgattgggtccgtaaggagaaaatcgagaagttg
gtgattcatttcgatctggacgttcttcatcctgatgtattccgctcgttgttatttgcc
gagccggagccggaattcgattggcgggcaacttacccggttgggcaattgcgtttggca
caggtgatcaggttgattcgcgatgttgccgctgaaacggagttggtggctattggcata
actgagcatcttccttgggatgtttggcacttgaaggagtctttaagtaaggttccattg
ctgaatcggtaa

DBGET integrated database retrieval system