KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08030Help
Entry
XFLM_08030        CDS       T01979                                 

Definition
arginase/agmatinase/formiminoglutamase family protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XFLM_08030
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XFLM_08030
Enzymes [BR:xff01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XFLM_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749111..1749962
Genome map
AA seq 283 aa AA seqDB search
MLFPQWQGGNQELYGLGARLLAWLAPETEAPMFEVNVPEFKKETPEPERGVIYRQQLFKQ
YDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLWIDAHPDIKTPQDSIN
GHTMVLGSLLGEGDNEFAAKVKVPLKPSRVMFAGLIETGLTEQETEVIHRLGLNVAKPEV
LFDNSQTVIDWVRKEKIEKLVIHFDLDVLHPDVFRSLLFAEPEPEFDWRATYPVGQLRLA
QVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttcctcaatggcaaggtggaaatcaggagctatatggtttgggcgcacgtctt
ctggcttggttggcgccggaaacagaggcgcctatgtttgaggtgaatgtgcctgagttt
aaaaaagaaacgcccgaaccggagagaggggttatctacaggcagcaattattcaagcag
tatgatgaagcttatcgactgttggagcgggaagatccggattatgtggtgatctttggt
ggtgattgcctggtggatttggcgccttttgcttggttgaatgagaaacatcatggtcag
ttgggtgtgttatggattgatgctcatcctgatataaaaacaccacaggattctataaat
ggtcacacgatggttctgggaagtttgctgggtgaaggtgataacgaatttgccgcaaag
gtgaaagttccgctgaagccgtccagggtgatgtttgcagggttgattgaaacggggttg
acggagcaggagactgaggtaattcatcgccttggactcaatgtggccaaaccggaggtg
ttatttgacaacagccagacggtgattgattgggtccgtaaggagaaaatcgagaagttg
gtgattcatttcgatctggacgttcttcatcctgatgtattccgctcgttgttatttgcc
gagccggagccggaattcgattggcgggcaacttacccggttgggcaattgcgtttggca
caggtgatcaggttgattcgcgatgttgccgctgaaacggagttggtggctattggcata
actgagcatcttccttgggatgtttggcacttgaaggagtctttaagtaaggttccattg
ctgaatcggtaa

DBGET integrated database retrieval system