KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08605Help
Entry
XFLM_08605        CDS       T01979                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XFLM_08605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XFLM_08605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XFLM_08605
Enzymes [BR:xff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XFLM_08605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1871036..1872253
Genome map
AA seq 405 aa AA seqDB search
MSDITVANYHAFPDARGHFGRYGGRFVAETLIGPLQELAQAYDAARHDPDFIAAYNKDLK
DYVGRPSPIYHAERLSRKVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIQRQQINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDYGRLPDAMTA
CVGGGSNAIGLFHAFLNDASVRIYGAEAAGDGIATGRHAASIVAGRPGVLHGNRTYVVCD
DDGQILETHSVSAGLDYPGVGPEHAFLADSGRVQYVGIRDEEALAAFHLLAHTEGILAAL
ESSHAVAHTMTLARDLPKDALVLCNLSGRGDKDVHTIAAREGVRV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattactgttgctaactatcatgctttccctgatgctcgcggccattttggg
cgttacggtggtcgttttgttgctgaaacgttgatcggaccgttgcaggagcttgcacag
gcctatgatgcggcgcgccatgatcccgatttcatcgccgcttataacaaggatctcaag
gattatgtgggtcgccccagtccgatctaccatgctgaacggctgagccgtaaggtgggt
ggcgctcaaattctgttgaagcgtgaggatcttaatcacaccggtgcgcacaaaatcaat
aacaccattggccaggccttgctggcagcacgtatgggcaagacacgcatcattgccgag
actggagccggtcagcatggtgtcgccagtgctactgtcgctgcgcgtttgggtttggag
tgtgtggtgtatatgggggctacggatatccagcggcagcagatcaacgtgtatcggatg
aagttgttgggtgcgacggtggtgcccgtgacttccggttcagccacactcaaggatgcg
cttaacgaagcgatgcgtgattgggtgacgcatgtggggcatacgttttatatcattggc
actgttgctggcccagatccgtatccgcgtatggtgcgcgacttcaacgcaattgttggc
cgtgaggcacgtgcgcagatgattgaagattatgggcgtttaccggatgcgatgactgct
tgtgttggcggtgggagtaatgccattggtttgttccatgccttcctcaatgatgcttcg
gtcaggatctatggtgctgaggcggctggagacggcattgcgacgggccgtcacgcggcc
tcaattgttgccggtcgtccgggagtgttgcatgggaatcgcacctacgtggtgtgtgat
gatgatggacagattttggaaacccattctgtatcagccggtttggattatccgggggtt
ggtcctgagcacgcttttttggctgacagtggccgggtgcagtatgtggggattcgggat
gaagaagcgttggctgcattccacttgcttgcacatactgaaggcatcttggctgcattg
gaatccagtcacgctgtggcccataccatgacgttggcgcgcgatcttcccaaagatgca
ttggtactgtgtaacttgtccggtcgcggtgataaggatgtgcacacgatcgcggcgcgc
gaaggtgtacgtgtctga

DBGET integrated database retrieval system