KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08815Help
Entry
XFLM_08815        CDS       T01979                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Brite
Enzymes [BR:xff01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XFLM_08815
Secretion system [BR:xff02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XFLM_08815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1918682..1919470)
Genome map
AA seq 262 aa AA seqDB search
MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNTTPANVQQRVTAALNTLDPDFKPDY
IGAAPFPGFREVVVSGQILYVSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQ
SQRIVFAPKNPQYTISVFTDIECGYCRKLHSEIAELNKQGIAVEYLAFPRMGLGSEDYKD
MVSVWCAADRKQALTEAKAGKKIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
YLPPEKLRALLDKLAAATAKGG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgccttatcgccgccttgttgctgggtatcgtgaccctcaccgcctgcgcacaa
ccctcacaacccagctccaacaaaacgagcaccacaccaaccaacaccacgccagccaac
gtgcaacaacgcgtgactgccgccctaaacactctggacccagatttcaagccagactac
atcggtgccgcaccattcccgggtttccgtgaagttgtggtcagcggccaaattctgtat
gtcagcgacaacggccgctacctcattcaggcacaaccctacgacattcaaaacaaaaaa
tttgctgtcagcgaagggctgctttcctaccgccgcacccaactagccacagtgccccaa
tcgcaacgcatcgtgttcgcaccaaagaacccccaatacaccatcagcgtattcaccgac
attgaatgcggctattgccggaaactacatagcgaaatcgccgaactgaataaacaaggc
atcgccgttgaatacctcgccttcccacggatgggtttaggaagcgaagattacaaagac
atggtctcagtgtggtgcgccgctgatcgtaaacaagcactgaccgaagcaaaagccggc
aaaaaaatccagaataaaaattgtaataaccctgttgccttggaatacagcctaggtcaa
cgtatcggcgtcaacggcaccccagcaatcttcgccccagacggcacccagcttggcggc
tatctaccaccagaaaaactacgtgcactgctggacaaactcgccgccgccacagctaaa
gggggctga

DBGET integrated database retrieval system